Property Summary

NCBI Gene PubMed Count 24
PubMed Score 39.93
PubTator Score 28.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
ependymoma 1.200 5.8e-03
Barrett's esophagus 2.500 1.5e-02
esophageal adenocarcinoma 3.000 1.8e-02
glioblastoma 2.200 4.3e-02
osteosarcoma 2.123 1.0e-03
group 4 medulloblastoma -1.900 5.7e-05
atypical teratoid / rhabdoid tumor 1.300 3.0e-03
medulloblastoma, large-cell 1.500 1.9e-04
primary pancreatic ductal adenocarcinoma -1.501 8.6e-03
non-small cell lung cancer 1.190 2.2e-09
lung cancer 1.700 1.1e-04
interstitial cystitis 1.400 3.9e-05
cystic fibrosis 1.100 4.4e-03
non primary Sjogren syndrome sicca -1.200 1.7e-02
nasopharyngeal carcinoma 1.600 6.3e-05
psoriasis -1.100 5.2e-06
Endometriosis -2.834 2.1e-02
lung carcinoma 1.700 3.5e-17
ulcerative colitis -1.100 5.6e-03
ovarian cancer 2.800 4.6e-06
pituitary cancer -1.300 1.3e-03
pancreatic cancer -1.500 3.9e-03
head and neck cancer 1.600 8.6e-04

 GWAS Trait (1)

Gene RIF (17)

PMID Text
24927598 Asparagine-linked (N-linked) glycosylation of ZIP14, particularly the glycosylation at N102, was required for efficient membrane extraction of ZIP14 and therefore is necessary for its iron sensitivity.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of solute carrier family 39, member 14 (SLC39A14) in primary human brain microvascular endothelial cells
24576911 These results suggest that both the up-regulation of ZIP14 and the down-regulation of ZnT10 by IL-6 might have enhanced the accumulation of manganese in SH-SY5Y cells.
24514587 Polymorphisms in SLC39A14 and SLC39A8 seemed to affect blood cadmium concentrations, for SLC39A14 this effect may occur via differential gene expression.
23110240 Data show the role of ZIP14 in the hepatocyte is multi-functional since zinc and iron trafficking are altered in the Zip14(-/-) mice and their phenotype shows defects in glucose homeostasis.
23052185 Zip14 expression induced by lipopolysaccharides in macrophages attenuates inflammatory response
22318508 Observations indicate that ZIP14 and ZIP8 are both broad-scope metal-ion transporters that can mediate the cellular uptake of nutritionally important metals as well as the toxic heavy metal cadmium.
22173985 the SLC39A14-exon4B transcript variant is a colorectal cancer biomarker with high sensitivity and organ-confined specificity.
22137264 Data suggest that Zip-14 mRNA level in enterocytes increases with iron or zinc depletion; Zip-14 transcript level in enterocytes decreases with zinc supplementation.
21462106 The transporter ZIP14 is up-regulated along the entire gastrointestinal tract by proinflammatory conditions.
21373779 ZIP14 downregulation is likely involved in the depletion of zinc in the hepatoma cells in Hepatocellular cancer
20938052 Alternative splicing of SLC39A14 was identified in colorectal tumors and found to be regulated by the Wnt pathway.
20682781 These results suggest that endosomal ZIP14 participates in the cellular assimilation of iron from transferrin, thus identifying a potentially new role for ZIP14 in iron metabolism.
20587610 Observational study of gene-disease association. (HuGE Navigator)
18524764 HFE decreases the stability of Zip14 and therefore reduces the iron loading in HepG2 cells
15863613 Zip14 expression is up-regulated through IL-6
15642354 ZIP14 (SLC39A14)was shown to function as a zinc influx transporter in a temperature-dependant manner.

AA Sequence

MKLLLLHPAFQSCLLLTLLGLWRTTPEAHASSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLD      1 - 70
VGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEEN     71 - 140
EQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEA    141 - 210
FGFNPLEDYYVSKSAVVFGGFYLFFFTEKILKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNG    211 - 280
DLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFI    281 - 350
DGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAG    351 - 420
SHFSANWIFALAGGMFLYISLADMFPEMNEVCQEDERKGSILIPFIIQNLGLLTGFTIMVVLTMYSGQIQ    421 - 490
IG                                                                        491 - 492
//

Text Mined References (31)

PMID Year Title
27231142 2016 Mutations in SLC39A14 disrupt manganese homeostasis and cause childhood-onset parkinsonism-dystonia.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24927598 2014 An iron-regulated and glycosylation-dependent proteasomal degradation pathway for the plasma membrane metal transporter ZIP14.
24576911 2014 Interleukin-6 enhances manganese accumulation in SH-SY5Y cells: implications of the up-regulation of ZIP14 and the down-regulation of ZnT10.
24514587 2014 Cadmium concentrations in human blood and urine are associated with polymorphisms in zinc transporter genes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23110240 2012 Zinc transporter ZIP14 functions in hepatic zinc, iron and glucose homeostasis during the innate immune response (endotoxemia).
23052185 2013 Zip14 expression induced by lipopolysaccharides in macrophages attenuates inflammatory response.
22318508 2012 Physiologic implications of metal-ion transport by ZIP14 and ZIP8.
22173985 2012 The exon-level biomarker SLC39A14 has organ-confined cancer-specificity in colorectal cancer.
22137264 2012 Coordinate expression and localization of iron and zinc transporters explain iron-zinc interactions during uptake in Caco-2 cells: implications for iron uptake at the enterocyte.
21917916 2011 Biochemical characterization of human ZIP13 protein: a homo-dimerized zinc transporter involved in the spondylocheiro dysplastic Ehlers-Danlos syndrome.
21462106 2010 Gastrointestinal factors influencing zinc absorption and homeostasis.
21373779 2012 ZIP14 zinc transporter downregulation and zinc depletion in the development and progression of hepatocellular cancer.
21269460 2011 Initial characterization of the human central proteome.
20938052 2011 Alternative splicing of SLC39A14 in colorectal cancer is regulated by the Wnt pathway.
20682781 2010 ZRT/IRT-like protein 14 (ZIP14) promotes the cellular assimilation of iron from transferrin.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18524764 2008 The hereditary hemochromatosis protein, HFE, inhibits iron uptake via down-regulation of Zip14 in HepG2 cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15863613 2005 Interleukin-6 regulates the zinc transporter Zip14 in liver and contributes to the hypozincemia of the acute-phase response.
15642354 2005 Structure-function analysis of a novel member of the LIV-1 subfamily of zinc transporters, ZIP14.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12659941 2003 The LZT proteins; the LIV-1 subfamily of zinc transporters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9391139 1997 Use of differential display analysis to assess the effect of human cytomegalovirus infection on the accumulation of cellular RNAs: induction of interferon-responsive RNAs.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.