Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.92
PubTator Score 8.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 5.1e-06
glioblastoma 1.400 2.5e-03
medulloblastoma, large-cell 1.200 1.2e-04
osteosarcoma 1.642 4.5e-04
ovarian cancer 1.200 1.3e-04

Gene RIF (7)

AA Sequence

MPGCPCPGCGMAGPRLLFLTALALELLERAGGSQPALRSRGTATACRLDNKESESWGALLSGERLDTWIC      1 - 70
SLLGSLMVGLSGVFPLLVIPLEMGTMLRSEAGAWRLKQLLSFALGGLLGNVFLHLLPEAWAYTCSASPGG     71 - 140
EGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAAEPGLGAV    141 - 210
VRSIKVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAA    211 - 280
KLQLSTALGGLLGAGFAICTQSPKGVVGCSPAAEETAAWVLPFTSGGFLYIALVNVLPDLLEEEDPWRSL    281 - 350
QQLLLLCAGIVVMVLFSLFVD                                                     351 - 371
//

Text Mined References (15)

PMID Year Title