Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.76
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.400 1.1e-02
glioblastoma -3.600 1.7e-04
oligodendroglioma -2.400 1.8e-11
ependymoma -2.100 9.0e-04
sonic hedgehog group medulloblastoma -4.900 3.5e-09
atypical teratoid / rhabdoid tumor -4.500 3.4e-09
medulloblastoma, large-cell -5.000 2.1e-06
primitive neuroectodermal tumor -4.400 3.3e-05
pediatric high grade glioma -3.400 6.8e-06
pilocytic astrocytoma -2.500 8.9e-05
pituitary cancer -1.700 3.0e-04

Gene RIF (5)

PMID Text
23716681 Data indicate that the zinc transporter ZIP12 (slc39a12) is highly expressed in brain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
16311021 Examination of the zinc transporter gene, SLC39A12.

AA Sequence

MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLE      1 - 70
KTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLYYIIHQEEICSSKLNMSNKEY     71 - 140
KFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQSQCMETKTLQKKSGIVSSEGANESTLPQLAA    141 - 210
MIITLSLQGVCLGQGNLPSPDYFTEYIFSSLNRTNTLRLSELDQLLNTLWTRSTCIKNEKIHQFQRKQNN    211 - 280
IITHDQDYSNFSSSMEKESEDGPVSWDQTCFSARQLVEIFLQKGLSLISKEDFKQMSPGIIQQLLSCSCH    281 - 350
LPKDQQAKLPPTTLEKYGYSTVAVTLLTLGSMLGTALVLFHSCEENYRLILQLFVGLAVGTLSGDALLHL    351 - 420
IPQVLGLHKQEAPEFGHFHESKGHIWKLMGLIGGIHGFFLIEKCFILLVSPNDKQGLSLVNGHVGHSHHL    421 - 490
ALNSELSDQAGRGKSASTIQLKSPEDSQAAEMPIGSMTASNRKCKAISLLAIMILVGDSLHNFADGLAIG    491 - 560
AAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMKTAILMNFISSLTAFMGLYIGLSVSADPCVQ    561 - 630
DWIFTVTAGMFLYLSLVEMLPEMTHVQTQRPWMMFLLQNFGLILGWLSLLLLAIYEQNIKI             631 - 691
//

Text Mined References (15)

PMID Year Title
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
23716681 2013 Neurulation and neurite extension require the zinc transporter ZIP12 (slc39a12).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16311021 2006 Examination of the zinc transporter gene, SLC39A12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12659941 2003 The LZT proteins; the LIV-1 subfamily of zinc transporters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.