Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.66
PubTator Score 4.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Pulmonary hypertension 86 3.016 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.200 2.6e-03
astrocytic glioma -2.400 1.1e-02
Astrocytoma, Pilocytic -2.500 8.8e-05
atypical teratoid / rhabdoid tumor -4.500 3.4e-09
ependymoma -2.100 9.0e-04
glioblastoma -2.600 2.3e-05
group 3 medulloblastoma -4.000 4.0e-05
medulloblastoma, large-cell -5.000 2.1e-06
oligodendroglioma -2.400 1.8e-11
pituitary cancer -1.700 3.0e-04
primitive neuroectodermal tumor -4.400 3.3e-05

Gene RIF (5)

AA Sequence

MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLE      1 - 70
KTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLYYIIHQEEICSSKLNMSNKEY     71 - 140
KFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQSQCMETKTLQKKSGIVSSEGANESTLPQLAA    141 - 210
MIITLSLQGVCLGQGNLPSPDYFTEYIFSSLNRTNTLRLSELDQLLNTLWTRSTCIKNEKIHQFQRKQNN    211 - 280
IITHDQDYSNFSSSMEKESEDGPVSWDQTCFSARQLVEIFLQKGLSLISKEDFKQMSPGIIQQLLSCSCH    281 - 350
LPKDQQAKLPPTTLEKYGYSTVAVTLLTLGSMLGTALVLFHSCEENYRLILQLFVGLAVGTLSGDALLHL    351 - 420
IPQVLGLHKQEAPEFGHFHESKGHIWKLMGLIGGIHGFFLIEKCFILLVSPNDKQGLSLVNGHVGHSHHL    421 - 490
ALNSELSDQAGRGKSASTIQLKSPEDSQAAEMPIGSMTASNRKCKAISLLAIMILVGDSLHNFADGLAIG    491 - 560
AAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMKTAILMNFISSLTAFMGLYIGLSVSADPCVQ    561 - 630
DWIFTVTAGMFLYLSLVEMLPEMTHVQTQRPWMMFLLQNFGLILGWLSLLLLAIYEQNIKI             631 - 691
//

Text Mined References (15)

PMID Year Title