Property Summary

NCBI Gene PubMed Count 32
PubMed Score 71.93
PubTator Score 51.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.100 8.5e-09
glioblastoma 1.500 6.9e-06
atypical teratoid / rhabdoid tumor 1.400 1.0e-06
pediatric high grade glioma 1.500 5.5e-08
pilocytic astrocytoma 1.300 5.5e-09
ovarian cancer 1.400 3.3e-07

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (22)

PMID Text
26081940 Despite the fact that these preliminary findings are unlikely to be of much diagnostic significance, these findings suggest that hZip1 plays a fundamental role in the carcinogenesis of mucinous tumors.
24922175 The effect of zinc administered for 27 days on the expression of ZIP1 in peripheral white blood cells is reported.
24878177 Data suggest that high zrt- and Irt-like protein 1 (hZIP1) expression may be an indicator of good prognosis in clear cell renal cell carcinoma (ccRCC).
24488210 Data indicate that zinc transporters ZnT1 and Zip1 were the most abundantly expressed zinc transporters in leukocytes.
23921484 Data indicate that the average expression level of zinc transporter Zip2 was significantly higher and zinc transporters Zip6, Zip8 mRNA levels were significantly lower in short stature children than in health controls.
23839533 Data indicate that the expression levels of ZnT and ZIP families in the three cell lines, when treated with high concentration of ZnSO4, increased and decreased corresponding to their functions, respectively.
22349685 The results of this study showed that signi fi cant positive correlations between ZIP1,ZnT1, and ZnT6 in most brain in patient with Alzheimer's disease.
21360563 RREB-1 overexpression results in down-regulation of hZIP1 and contributes to the loss of hZIP1 expression and zinc in prostate cancer.
21103883 Differentiated Caco-2 cells tolerate significantly higher levels of zinc compared to undifferentiated Caco-2 cells, which was accompanied by upregulated ZnT-1 and downregulated ZIP1 levels.
21053094 The metallothionein gene had a higher expression in the blood, when compared to zinc transporters ZnT-1, Zip-1, and Zip-3 (p=0.01 in obese patients.
20705137 the expression of human Zn transporter1 (hZIP1) appears to correlate with the Zn levels in the prostate glands and may be the major Zn regulator in this organ.
20471814 GSPE and EGCG enhance the expression of cellular zinc importers ZIP1 (SLC39A1).
19802870 Ras pathway and activation of RREB-1 are involved in hZIP1 down-regulation and may play a role in the decrease of the transporter expression in prostate cancer.
19644445 ZIP is a novel transcription repressor, represses EGFR oncogene and suppresses breast carcinogenesis
19026724 The core promoter region responsible for constitutive expression of hZip1 were identified and critical roles for SP1 and CREB1 in transcriptional regulation of the hZip1 gene in prostate cancer cells, was demonstrated.
18765529 results show that hZIP1 overexpression has a functional effect on the malignant potential of prostate cancer cells via inhibition of NF-kappaB-dependent pathways and support the concept that hZIP1 may function as a tumor suppressor gene
18279033 Gene expression regulation of ZIPs after zinc supplementation.
17635580 di-leucine sorting signal of ZIP1 was required and sufficient for endocytosis of the chimeric proteins
16203195 In conclusion, these studies provide important insights into the role of a plasma membrane zinc transporter (ZIP1) in the initiation of an osteogenic lineage from MSCs.
16153295 down regulation of hZIP1 is a critical early event in the development prostate cancer
14525987 ZIP1, ZIP2 and ZIP3 may play cell-specific roles in zinc homeostasis rather than primary roles in the acquisition of dietary zinc
12888280 zip1 mechanism of transport appears to involve the transport of zinc from low molecular weight ligands that exist in circulation as relatively loosely bound complexes with zinc

AA Sequence

MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALS      1 - 70
LVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPS     71 - 140
PLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMEL    141 - 210
CLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAA    211 - 280
GTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFIQI                              281 - 324
//

Text Mined References (34)

PMID Year Title
26081940 2015 Persistent low expression of hZip1 in mucinous carcinomas of the ovary, colon, stomach and lung.
24922175 2014 Zinc fortification decreases ZIP1 gene expression of some adolescent females with appropriate plasma zinc levels.
24878177 2014 hZIP1 that is down-regulated in clear cell renal cell carcinoma is negatively associated with the malignant potential of the tumor.
24488210 2014 The alteration of zinc transporter gene expression is associated with inflammatory markers in obese women.
23921484 2013 Zip1, Zip2, and Zip8 mRNA expressions were associated with growth hormone level during the growth hormone provocation test in children with short stature.
23839533 2013 Effects of exogenous zinc on cell cycle, apoptosis and viability of MDAMB231, HepG2 and 293 T cells.
22903471 2013 Genome-wide association identifies genetic variants associated with lentiform nucleus volume in N?=?1345 young and elderly subjects.
22349685 2012 Zinc transporter mRNA levels in Alzheimer's disease postmortem brain.
21360563 2011 hZIP1 zinc transporter down-regulation in prostate cancer involves the overexpression of ras responsive element binding protein-1 (RREB-1).
21269460 2011 Initial characterization of the human central proteome.
21103883 2011 Differentiation- and polarization-dependent zinc tolerance in Caco-2 cells.
21053094 2011 Expression of the zinc transporters genes and metallothionein in obese women.
20705137 2010 Differential zinc accumulation and expression of human zinc transporter 1 (hZIP1) in prostate glands.
20471814 2011 Dietary catechins and procyanidins modulate zinc homeostasis in human HepG2 cells.
19802870 2010 Ras responsive element binding protein-1 (RREB-1) down-regulates hZIP1 expression in prostate cancer cells.
19644445 2009 ZIP: a novel transcription repressor, represses EGFR oncogene and suppresses breast carcinogenesis.
19026724 2009 Transcriptional regulation of the major zinc uptake protein hZip1 in prostate cancer cells.
18765529 2008 Overexpression of the zinc uptake transporter hZIP1 inhibits nuclear factor-kappaB and reduces the malignant potential of prostate cancer cells in vitro and in vivo.
18279033 2008 Zinc supplementation in the elderly reduces spontaneous inflammatory cytokine release and restores T cell functions.
17635580 2007 A di-leucine sorting signal in ZIP1 (SLC39A1) mediates endocytosis of the protein.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16203195 2006 Overexpression of the ZIP1 zinc transporter induces an osteogenic phenotype in mesenchymal stem cells.
16153295 2005 hZIP1 zinc uptake transporter down regulation and zinc depletion in prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525987 2003 Structure, function, and regulation of a subfamily of mouse zinc transporter genes.
12888280 2003 Human ZIP1 is a major zinc uptake transporter for the accumulation of zinc in prostate cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11696349 2001 Differential subcellular localization of hZip1 in adherent and non-adherent cells.
11301334 2001 The human ZIP1 transporter mediates zinc uptake in human K562 erythroleukemia cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10681536 2000 Functional expression of the human hZIP2 zinc transporter.
10610721 1999 Isolation and characterization of human and mouse ZIRTL, a member of the IRT1 family of transporters, mapping within the epidermal differentiation complex.