Property Summary

NCBI Gene PubMed Count 16
PubMed Score 46.80
PubTator Score 23.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 5.4e-03
pancreatic ductal adenocarcinoma liver m... -2.795 2.5e-03
intraductal papillary-mucinous adenoma (... -1.700 4.6e-02
colon cancer -2.700 7.7e-03
active Crohn's disease -2.505 6.4e-04
active ulcerative colitis -3.937 1.2e-04
Breast cancer -1.200 4.7e-02
lung carcinoma 1.500 6.4e-08

Gene RIF (6)

PMID Text
25063848 PAAT is a novel ATPase and a trans-regulator of mitochondrial ABC transporters that plays an important role in the maintenance of mitochondrial homeostasis
22945694 Our results suggest that mutant allele A for SNP 1304 G>A of SLC38A4 gene is associated with hyperglycaemia.
21917917 Membrane topological structure of neutral system N/A amino acid transporter 4 (SNAT4) protein
19015196 the contribution of SNAT4 to system A-mediated placental microvillous transport decreases between first trimester and term
18703994 Report SNAT4 activity in fetal T lymphocytes in intrauterine growth restriction and with tumor necrosis factor-alpha treatment.
16148032 evidence of SNAT4 mRNA and protein expression in the human placenta, both at the first trimester and at full term

AA Sequence

MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGKKKLADYADEH      1 - 70
HPGTTSFGMSSFNLSNAIMGSGILGLSYAMANTGIILFIIMLLAVAILSLYSVHLLLKTAKEGGSLIYEK     71 - 140
LGEKAFGWPGKIGAFVSITMQNIGAMSSYLFIIKYELPEVIRAFMGLEENTGEWYLNGNYLIIFVSVGII    141 - 210
LPLSLLKNLGYLGYTSGFSLTCMVFFVSVVIYKKFQIPCPLPVLDHSVGNLSFNNTLPMHVVMLPNNSES    211 - 280
SDVNFMMDYTHRNPAGLDENQAKGSLHDSGVEYEAHSDDKCEPKYFVFNSRTAYAIPILVFAFVCHPEVL    281 - 350
PIYSELKDRSRRKMQTVSNISITGMLVMYLLAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVL    351 - 420
VAVTLTVPIVLFPIRTSVITLLFPKRPFSWIRHFLIAAVLIALNNVLVILVPTIKYIFGFIGASSATMLI    421 - 490
FILPAVFYLKLVKKETFRSPQKVGALIFLVVGIFFMIGSMALIIIDWIYDPPNSKHH                 491 - 547
//

Text Mined References (16)

PMID Year Title
25063848 2014 PAAT, a novel ATPase and trans-regulator of mitochondrial ABC transporters, is critically involved in the maintenance of mitochondrial homeostasis.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
22945694 2013 Association of the polymorphisms 292?C>T and 1304?G>A in the SLC38A4 gene with hyperglycaemia.
21917917 2011 Membrane topological structure of neutral system N/A amino acid transporter 4 (SNAT4) protein.
19015196 2009 The SNAT4 isoform of the system A amino acid transporter is functional in human placental microvillous plasma membrane.
18703994 2009 Amino acid transport systems beta and A in fetal T lymphocytes in intrauterine growth restriction and with tumor necrosis factor-alpha treatment.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16148032 2006 SNAT4 isoform of system A amino acid transporter is expressed in human placenta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12845534 2004 Sodium-coupled neutral amino acid (System N/A) transporters of the SLC38 gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11414754 2001 A novel human amino acid transporter, hNAT3: cDNA cloning, chromosomal mapping, genomic structure, expression, and functional characterization.
11342143 2001 Evidence for the transport of neutral as well as cationic amino acids by ATA3, a novel and liver-specific subtype of amino acid transport system A.