Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.06
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Rheumatoid Arthritis 1170 4.3e-02
Disease Target Count Z-score Confidence
Glycogen storage disease 37 4.118 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.3e-02

Gene RIF (1)

PMID Text
21752829 SLC37A3 protein localizes in lysosomes in HeLa cells

AA Sequence

MAWPNVFQRGSLLSQFSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSS      1 - 70
NHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYN     71 - 140
KWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFL    141 - 210
VTASVQFAGGIVIFFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKA    211 - 280
ISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFIS    281 - 350
DVLQKRAPVLALSLLLAVGSLIGYSRSPNDKSINALLMTVTGFFIGGPSNMISSAISADLGRQELIQRSS    351 - 420
EALATVTGIVDGSGSIGAAVGQYLVSLIRDKLGWMWVFYFFILMTSCTIVFISPLIVREIFSLVLRRQAH    421 - 490
ILRE                                                                      491 - 494
//

Text Mined References (11)

PMID Year Title
21949678 2011 SLC37A1 and SLC37A2 are phosphate-linked, glucose-6-phosphate antiporters.
21752829 2011 Characterization of the CLEAR network reveals an integrated control of cellular clearance pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12811562 2004 The human sugar-phosphate/phosphate exchanger family SLC37.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9847074 1998 Toward a complete human genome sequence.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.