Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.07
PubTator Score 2.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -2.410 4.8e-02
adrenocortical carcinoma -1.746 1.6e-05
cystic fibrosis 1.062 5.3e-04
inflammatory breast cancer 1.200 2.2e-04
interstitial cystitis -1.100 3.7e-02
non primary Sjogren syndrome sicca 1.100 2.5e-02
tuberculosis and treatment for 3 months -1.100 5.0e-03
ulcerative colitis -1.300 4.4e-02

Gene RIF (1)

AA Sequence

MRSSLAPGVWFFRAFSRDSWFRGLILLLTFLIYACYHMSRKPISIVKSRLHQNCSEQIKPINDTHSLNDT      1 - 70
MWCSWAPFDKDNYKELLGGVDNAFLIAYAIGMFISGVFGERLPLRYYLSAGMLLSGLFTSLFGLGYFWNI     71 - 140
HELWYFVVIQVCNGLVQTTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNILGSLIAGIWVNGQWGLS    141 - 210
FIVPGIITAVMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPC    211 - 280
EEPAAISFFGALRIPGVVEFSLCLLFAKLVSYTFLYWLPLYIANVAHFSAKEAGDLSTLFDVGGIIGGIV    281 - 350
AGLVSDYTNGRATTCCVMLILAAPMMFLYNYIGQDGIASSIVMLIICGGLVNGPYALITTAVSADLGTHK    351 - 420
SLKGNAKALSTVTAIIDGTGSIGAALGPLLAGLISPTGWNNVFYMLISADVLACLLLCRLVYKEILAWKV    421 - 490
SLSRGSGYKEI                                                               491 - 501
//

Text Mined References (7)

PMID Year Title