Property Summary

Ligand Count 4
NCBI Gene PubMed Count 42
PubMed Score 31.77
PubTator Score 57.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hartnup disease 13 4.593 2.3

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.300 2.1e-07
group 4 medulloblastoma -1.900 5.0e-06
malignant mesothelioma 2.200 4.1e-08
medulloblastoma, large-cell -1.900 1.3e-06
osteosarcoma 1.236 1.4e-06
ovarian cancer 1.200 1.3e-11
ulcerative colitis -1.600 3.2e-08

Gene RIF (17)

AA Sequence

MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGNIGTGLLGLPL      1 - 70
AVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGR     71 - 140
RVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVF    141 - 210
IRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLEN    211 - 280
KMKDPRKFPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQ    281 - 350
FYVPAEIIIPFFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLE    351 - 420
VTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI                  421 - 476
//

Text Mined References (45)

PMID Year Title