Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.88
PubTator Score 1.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
nephrosclerosis 1.095 1.6e-04
astrocytic glioma -1.300 3.8e-02
ependymoma -1.500 1.8e-02
oligodendroglioma -1.700 1.4e-02
intraductal papillary-mucinous adenoma (... -1.800 5.2e-03
intraductal papillary-mucinous carcinoma... -1.800 2.3e-03
breast carcinoma -1.300 9.2e-04
fibroadenoma -1.400 3.5e-02
interstitial cystitis 1.300 2.9e-04
cystic fibrosis 1.100 1.5e-03
subependymal giant cell astrocytoma -2.569 1.3e-02
lung carcinoma 1.400 3.3e-27
ductal carcinoma in situ -1.300 5.9e-04
invasive ductal carcinoma -1.400 1.1e-02
ovarian cancer -1.800 1.2e-10

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19148500 the TMEM22/RAB37 complex is likely to play a crucial role in growth of renal cell carcinoma

AA Sequence

MDTSPSRKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEGYGNFMEENPKKGLLSEMKKKGRAFFG      1 - 70
TMDTLPPPTEDPMINEIGQFQSFAEKNIFQSRKMWIVLFGSALAHGCVALITRLVSDRSKVPSLELIFIR     71 - 140
SVFQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILA    141 - 210
FLLVDEKMAYVDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKE    211 - 280
KISMWTALFTFGWTGTIWGISTMFILQEPIIPLDGETWSYLIAICVCSTAAFLGVYYALDKFHPALVSTV    281 - 350
QHLEIVVAMVLQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSPIK            351 - 412
//

Text Mined References (16)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19148500 2009 Involvement of TMEM22 overexpression in the growth of renal cell carcinoma cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.