Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.25
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.5e-20
ependymoma 4679 4.9e-09
pituitary cancer 1972 5.3e-07
glioblastoma 5792 3.1e-04
Astrocytoma, Pilocytic 3081 1.5e-03
medulloblastoma 720 7.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic -1.300 1.5e-03
ependymoma -1.400 4.9e-09
glioblastoma -1.100 3.1e-04
medulloblastoma -1.300 7.5e-03
pituitary cancer 2.600 5.3e-07
psoriasis -1.700 4.5e-20

AA Sequence

MDELLLDLFHKLTSGRQLAAGNGLCGISHKEQEVWKPGHNILVKMRKEDKSLVWLIHSTLARYTQVTNFL      1 - 70
GTSRSSVTRCKPGANCPSSHSGISRQLSPLSVTEDSSAPILELQNQGSSGVCGHRVERQNRSADDGTQTH     71 - 140
SENSSQENRIKARCLSCTSMVLKGIWGLLIILSVSSSWVGTTQIVKITYKNFYCPFFMTWFSTNWNIMFF    141 - 210
PVYYSGHLATAQEKQSPMKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSA    211 - 280
LFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFAVGSASTSALYKVLF    281 - 350
KMFLGSANFGEAAHFVSTLGFFNLIFISFTPVILYFTKVEHWSSFAALPWGCLCGMAGLWLAFNILVNVG    351 - 420
VVLTYPILISIGTVLSVPGNAAVDLLKQEVIFNVVRLAATIIICIGFLLMLLPEEWDEITLRFINSLKEK    421 - 490
KSEEHVDDVTDPSIHLRGRGRANGTVSIPLA                                           491 - 521
//

Text Mined References (6)

PMID Year Title