Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.07
PubTator Score 5.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.200 2.2e-04
atypical teratoid / rhabdoid tumor 1.700 4.6e-04
Breast cancer 2.100 3.6e-02
colon cancer 1.800 1.7e-02
ependymoma 1.300 6.5e-07
glioblastoma 1.100 1.9e-03
group 3 medulloblastoma 1.400 1.4e-03
lung adenocarcinoma 1.100 6.7e-08
lung cancer -1.800 6.2e-03
medulloblastoma, large-cell 2.200 7.1e-05
non primary Sjogren syndrome sicca 1.100 2.2e-02
non-small cell lung carcinoma 1.300 1.0e-20
psoriasis -2.100 9.6e-05

Gene RIF (2)

AA Sequence

MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVN      1 - 70
TPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYTTLTSVQLL     71 - 140
DCFGIPVLMALSWFILHARYRVIHFIAVAVCLLGVGTMVGADILAGREDNSGSDVLIGDILVLLGASLYA    141 - 210
ISNVCEEYIVKKLSRQEFLGMVGLFGTIISGIQLLIVEYKDIASIHWDWKIALLFVAFALCMFCLYSFMP    211 - 280
LVIKVTSATSVNLGILTADLYSLFVGLFLFGYKFSGLYILSFTVIMVGFILYCSTPTRTAEPAESSVPPV    281 - 350
TSIGIDNLGLKLEENLQETHSAVL                                                  351 - 374
//

Text Mined References (13)

PMID Year Title