Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.84
PubTator Score 0.69

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.900 2.3e-03
Astrocytoma, Pilocytic 1.500 1.8e-05
atypical teratoid / rhabdoid tumor -1.900 3.8e-03
group 3 medulloblastoma -1.600 1.0e-02
interstitial cystitis 1.100 5.3e-03
lung carcinoma 1.200 3.8e-19
medulloblastoma, large-cell -1.600 5.8e-03
Pick disease -1.200 8.5e-03
pituitary cancer 3.000 3.1e-07

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MIPPEQPQQQLQPPSPAPPNHVVTTIENLPAEGSGGGGSLSASSRAGVRQRIRKVLNREMLISVALGQVL      1 - 70
SLLICGIGLTSKYLSEDFHANTPVFQSFLNYILLFLVYTTTLAVRQGEENLLAILRRRWWKYMILGLIDL     71 - 140
EANYLVVKAYQYTTLTSIQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQ    141 - 210
GAGENKLVGDLLVLGGATLYGISNVWEEYIIRTLSRVEFLGMIGLFGAFFSGIQLAIMEHKELLKVPWDW    211 - 280
QIGLLYVGFSACMFGLYSFMPVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYKFSGLYLLSFFTILIGL    281 - 350
VLYSSTSTYIAQDPRVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA                351 - 408
//

Text Mined References (14)

PMID Year Title