Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 0.26

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MALLVDRVRGHWRIAAGLLFNLLVSICIVFLNKWIYVYHGFPNMSLTLVHFVVTWLGLYICQKLDIFAPK      1 - 70
SLPPSRLLLLALSFCGFVVFTNLSLQNNTIGTYQLAKAMTTPVIIAIQTFCYQKTFSTRIQLTLIPITLG     71 - 140
VILNSYYDVKFNFLGMVFAALGVLVTSLYQVWVGAKQHELQVNSMQLLYYQAPMSSAMLLVAVPFFEPVF    141 - 210
GEGGIFGPWSVSALLMVLLSGVIAFMVNLSIYWIIGNTSPVTYNMFGHFKFCITLFGGYVLFKDPLSINQ    211 - 280
ALGILCTLFGILAYTHFKLSEQEGSRSKLAQRP                                         281 - 313
//

Text Mined References (9)

PMID Year Title