Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.200 5.1e-05
lung cancer 1.300 1.1e-02
ovarian cancer 1.300 3.3e-04
pediatric high grade glioma -1.200 5.7e-03
Pick disease 1.300 4.6e-04
posterior fossa group B ependymoma -1.100 1.6e-03
spina bifida -1.741 4.0e-02

AA Sequence

MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGV      1 - 70
WSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGCVKTLVPCCLYQHKARLSYPP     71 - 140
NFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGRPSDREEREELQLQ    141 - 210
PGRGAAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLPAS                  211 - 266
//

Text Mined References (5)

PMID Year Title