Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma -1.697 5.7e-03
astrocytic glioma 1.800 6.4e-03
ependymoma 2.100 1.4e-03
oligodendroglioma 2.000 9.1e-04
esophageal adenocarcinoma 1.200 2.0e-02
psoriasis 1.300 1.4e-04
osteosarcoma 3.235 2.2e-10
adrenocortical carcinoma 1.017 1.2e-03
pancreatic ductal adenocarcinoma liver m... 2.317 3.1e-03
Breast cancer 2.400 2.8e-02
non primary Sjogren syndrome sicca 1.100 2.5e-02
Pick disease 1.300 1.7e-08
ovarian cancer 1.700 1.0e-06
cystic fibrosis and chronic rhinosinusit... 1.011 1.8e-02

AA Sequence

MAAAAVGAGHGAGGPGAASSSGGAREGARVAALCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALC      1 - 70
AGLPPLLRAWRVPPAPPVSGPGPSPHPSSGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHT     71 - 140
VKATMPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLATVTELSFDMWGLVSALAATLCFSLQNIFSKK    141 - 210
VLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAF    211 - 280
SILNLVSPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPV    281 - 350
TTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV              351 - 410
//

Text Mined References (6)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.