Property Summary

NCBI Gene PubMed Count 2
PubMed Score 4.22
PubTator Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 9.3e-03
lung carcinoma 4.000 2.3e-40
osteosarcoma -2.989 9.2e-09
ovarian cancer 1.500 3.4e-02
psoriasis -1.600 4.5e-14

Gene RIF (1)

AA Sequence

MRQLCRGRVLGISVAIAHGVFSGSLNILLKFLISRYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPF      1 - 70
GLSLARSFAGVAVLSTLQSSLTLWSLRGLSLPMYVVFKRCLPLVTMLIGVLVLKNGAPSPGVLAAVLITT     71 - 140
CGAALAGAGDLTGDPIGYVTGVLAVLVHAAYLVLIQKASADTEHGPLTAQYVIAVSATPLLVICSFASTD    141 - 210
SIHAWTFPGWKDPAMVCIFVACILIGCAMNFTTLHCTYINSAVTTSFVGVVKSIATITVGMVAFSDVEPT    211 - 280
SLFIAGVVVNTLGSIIYCVAKFMETRKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGE    281 - 350
AAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYMKKDYLIENEELPSP        351 - 416
//

Text Mined References (5)

PMID Year Title