Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.86
PubTator Score 7.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Craniofacial Abnormalities 141 0.0 0.0
Schneckenbecken dysplasia 5 0.0 0.0
Disease Target Count Z-score Confidence
Crohn's disease 311 0.0 3.0
Disease Target Count Z-score Confidence
Osteochondrodysplasia 6 3.764 1.9

Expression

  Differential Expression (14)

Gene RIF (4)

AA Sequence

MAEVHRRQHARVKGEAPAKSSTLRDEEELGMASAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFP      1 - 70
SSLCVGLGQMVATVAVLWVGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRR     71 - 140
FSILFTMFAEGVLLKKTFSWGIKMTVFAMIIGAFVAASSDLAFDLEGYAFILINDVLTAANGAYVKQKLD    141 - 210
SKELGKYGLLYYNALFMILPTLAIAYFTGDAQKAVEFEGWADTLFLLQFTLSCVMGFILMYATVLCTQYN    211 - 280
SALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIK    281 - 350
GKGAV                                                                     351 - 355
//

Text Mined References (14)

PMID Year Title