Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.85
PubTator Score 3.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Synonym

Accession L0R6Q1
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MADDKDSLPKLKDLAFLKNQLESLQRRVEDEVNSGVGQDGSLLSSPFLKGFLAGYVVAKLRASAVLGFAV      1 - 70
GTCTGIYAAQAYAVPNVEKTLRDYLQLLRKGPD                                          71 - 103
//

Text Mined References (7)

PMID Year Title