Property Summary

NCBI Gene PubMed Count 34
PubMed Score 86.75
PubTator Score 71.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 7.6e-03
non-small cell lung cancer -2.402 5.9e-11
lung cancer -6.700 1.1e-05
lung carcinoma -5.800 1.6e-54
ovarian cancer 2.100 9.7e-04
facioscapulohumeral dystrophy 6.100 6.8e-26

Gene RIF (21)

PMID Text
26506223 SPAK and OSR1 are powerful stimulators of the intestinal Na+-coupled phosphate co-transporter NaPi-IIb
26156586 our data indicated that SLC34A2 could exert significantly suppressive effects on tumorigenesis and progression of NSCLC. SLC34A2 might provide new insights for further understanding the early pathogenesis of human non-small cell lung cancer
25017204 SLC34A2 might be associated with the initiation and progression of lung adenocarcinoma
23936189 Data indicate that humanized monoclonal antibody Rebmab200 and murine monoclonal antibody MX35 monoclonal antibodies had similar specificity for sodium phosphate transporter NaPi2b.
23164546 investigation revealed that the c.910A > T mutation in the SCL34A2 gene was responsible for pulmonary alveolar microlithiasis (PAM) patients in China
22553815 a comprehensive analysis indicates that SCL34A2 is the only gene of the several phosphate transporters genes whose expression differentiates normal from carcinoma samples, suggesting it might exert a major role in ovarian carcinomas.
22336687 identified 2 cases of pulmonary alveolar microlithiasis(PAM) with new mutations of SLC34A2 gene; identified the NaPi-IIb in a aortic valve; hypothesize that mutations in SLC34A2 may play a role in development of aortic valve calcification and arteriosclerosis
21956469 study provides the data on the pattern of NaPi2b expression and cellular localization in breast, lung and ovarian cancers
21716206 Upregulation of SLC34A2 gene expression in well-differentiated tumors may reflect cell differentiation processes during ovarian cancerogenesis and could serve as potential marker for ovarian cancer diagnosis and prognosis.
21036732 There was a significantly increased gene expression of SLC34A2 (normal tissues: 6.71+/-0.77; tumour tissues: 10.29+/-0.80) among breast cancer tissues compared with normal tissues.
20457063 Observational study of gene-disease association. (HuGE Navigator)
20046000 study describes mutations in SLC34A 2 gene in an inbred Turkish family with three siblings diagnosed with pulmonary alveolar microlithiasis(PAM); findings suggest that impaired activity of the SLC34A2 gene may be responsible for familial PAM
20017296 A novel mutation in exon 8 of the SLC34A2 gene were associated with pulmonary alveolar microlithiasis in Chinese pedigree.
19617834 The gene responsible for PAM, SLC34A2, has been identified. It encodes a type IIb sodium-dependent phosphate transporter, the function of which provides an insight into the pathogenesis of this disease.
19134407 In human lung alveolar epithelial cells, the content of calcium and phosphate in cell supernatant decreased with increased amount of SLC34A2 mRNA.
19119262 SLC34A2 is associated with sodium-lithium countertransport activity and blood pressure
18724815 The monoclonal antibodies were shown to recognize specifically transiently overexpressed and endogenous NaPi2b in commonly used immunoassays.
17095743 Mutations in the SLC34A2 gene that abolish normal gene function cause pulmonary alveolar microlithiasis.
17091453 The performed study revealed that SLC34A2 gene exhibited the most distinct change in expression and may become a molecular marker of papillary thyroid cancer
16960801 Study identified a pulmonary alveolar microlithiasis locus by homozygosity mapping to 4p15, then identified, by a candidate-gene approach, the gene responsible for the disease as SLC34A2, which is involved in phosphate homeostasis in several organs.
15458926 The current study was performed to characterize the minimal promoter region and transcriptional factor(s) necessary to activate gene expression of NaPi-IIb in human intestinal cells.

AA Sequence

MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLIDEPTEVDDPW      1 - 70
NLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSSAFQLVGGKMAGQFFSNSSIM     71 - 140
SNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRAAIPIIMGANIGTSITNTIVALMQVGDRSEF    141 - 210
RRAFAGATVHDFFNWLSVLVLLPVEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDK    211 - 280
KVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKC    281 - 350
QHIFVNFHLPDLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI    351 - 420
LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNALRSSLQIALC    421 - 490
HFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLIPLTVFGLSLAGWRVLVGVGV    491 - 560
PVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACC    561 - 630
LLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTAL              631 - 690
//

Text Mined References (37)

PMID Year Title
26506223 2015 Up-Regulation of Intestinal Phosphate Transporter NaPi-IIb (SLC34A2) by the Kinases SPAK and OSR1.
26156586 2015 The effects and mechanisms of SLC34A2 in tumorigenesis and progression of human non-small cell lung cancer.
25017204 2014 Elevated expression of SLC34A2 inhibits the viability and invasion of A549 cells.
23936189 2013 Rebmab200, a humanized monoclonal antibody targeting the sodium phosphate transporter NaPi2b displays strong immune mediated cytotoxicity against cancer: a novel reagent for targeted antibody therapy of cancer.
23164546 2013 SLC34A2 Gene mutation of pulmonary alveolar microlithiasis: report of four cases and review of literatures.
22553815 2012 In silico analysis and immunohistochemical characterization of NaPi2b protein expression in ovarian carcinoma with monoclonal antibody Mx35.
22336687 2012 SLC34A2 gene mutation may explain comorbidity of pulmonary alveolar microlithiasis and aortic valve sclerosis.
21956469 2011 Immunohistochemical analysis of NaPi2b protein (MX35 antigen) expression and subcellular localization in human normal and cancer tissues.
21716206 2011 Quantitative analysis of SLC34A2 expression in different types of ovarian tumors.
21036732 2010 SLC34A2 as a novel marker for diagnosis and targeted therapy of breast cancer.
20457063 2010 Human eye colour and HERC2, OCA2 and MATP.
20046000 2010 A frame-shift mutation in the SLC34A2 gene in three patients with pulmonary alveolar microlithiasis in an inbred family.
20017296 2009 [A novel mutation of the SLC34A2 gene in a Chinese pedigree with pulmonary alveolar microlithiasis].
19617834 2009 Pulmonary alveolar microlithiasis: review and management.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19134407 2008 [Detection of SLC34A2 in patients with pulmonary alveolar microlithiasis and the effect of SLC34A2 on transportation of calcium and phosphate in human alveolar epithelial cells].
19119262 2009 Association of SLC34A2 variation and sodium-lithium countertransport activity in humans and baboons.
18724815 2008 Development of monoclonal antibodies specific for the human sodium-dependent phosphate co-transporter NaPi2b.
17095743 2007 Mutations in the SLC34A2 gene are associated with pulmonary alveolar microlithiasis.
17091453 2006 [Expression of selected genes involved in transport of ions in papillary thyroid carcinoma].
16960801 2006 Mutations in SLC34A2 cause pulmonary alveolar microlithiasis and are possibly associated with testicular microlithiasis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15970207 2005 Sodium-phosphate cotransporter in human salivary glands: molecular evidence for the involvement of NPT2b in acinar phosphate secretion and ductal phosphate reabsorption.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15458926 2005 NF1 transcriptional factor(s) is required for basal promoter activation of the human intestinal NaPi-IIb cotransporter gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12893629 2003 Regulation of intestinal NaPi-IIb cotransporter gene expression by estrogen.
12661006 2003 Fusion of FIG to the receptor tyrosine kinase ROS in a glioblastoma with an interstitial del(6)(q21q21).
12488042 2002 Functional characterization of the human intestinal NaPi-IIb cotransporter in hamster fibroblasts and Xenopus oocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11880379 2002 Growth-related renal type II Na/Pi cotransporter.
11171583 2001 Regulation of the human sodium-phosphate cotransporter NaP(i)-IIb gene promoter by epidermal growth factor.
10610722 1999 Molecular cloning, functional characterization, tissue distribution, and chromosomal localization of a human, small intestinal sodium-phosphate (Na+-Pi) transporter (SLC34A2).
10329428 1999 Cloning and functional characterization of a sodium-dependent phosphate transporter expressed in human lung and small intestine.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.