Property Summary

NCBI Gene PubMed Count 14
PubMed Score 54.97
PubTator Score 25.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (10)

AA Sequence

MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPTSISQQTIAET      1 - 70
DGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYLAYPLL     71 - 140
STA                                                                       141 - 143
//

Text Mined References (15)

PMID Year Title