Property Summary

NCBI Gene PubMed Count 197
PubMed Score 167.99
PubTator Score 165.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.100 7.6e-09
intraductal papillary-mucinous adenoma (... -2.500 3.4e-02

Gene RIF (189)

AA Sequence

MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPTEKGANEYAYA      1 - 70
KWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAE     71 - 140
ILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQRCLGHNHKEVQA    141 - 210
NASVRAAFVHALGDLFQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPK    211 - 280
SLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQ    281 - 350
MESPVDQDPDCLFCEDPCD                                                       351 - 369
//

Text Mined References (201)

PMID Year Title