Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.88
PubTator Score 7.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
ovarian cancer 8491 6.0e-04
diabetes mellitus 1663 2.0e-03
Disease Target Count Z-score Confidence
Acrodermatitis enteropathica 18 3.359 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.300 2.0e-03
ovarian cancer 1.600 6.0e-04

Protein-protein Interaction (5)

Gene RIF (9)

PMID Text
25284286 results of this study suggested that ZnT6 protein levels are decreased in the spinal cords of sporadic ALS patients.
22349685 The results of this study showed that signi fi cant positive correlations between ZIP1,ZnT1, and ZnT6 in most brain in patient with Alzheimer's disease.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19759014 The cytosolic C-terminal tail of ZnT5 is important for its interaction with ZnT6 as a heterodimer.
19371353 our results suggest that alterations in Zn transport proteins ZnT-1, ZnT-4 and ZnT-6 may contribute to the pathology observed in preclinical Alzheimer's disease subjects before onset of clinical symptoms
19064571 Observational study of gene-disease association. (HuGE Navigator)
18639746 Data show that ZNT6 is extensively present in the Abeta-positive plaques in the cortex of human AD brains.
17971500 hZnT-6 is up-regulated in response to cellular zinc depletion in Raji & THP-1 cells.
16580781 Our results show that Zn transporter-4 and Zn transporter-6 are significantly (P<0.05) increased in hippocampus/parahippocampal gyrus of early Alzheimer's disease and Alzheimer's disease subjects.

AA Sequence

MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIALTAYTYLTIFD      1 - 70
LFSLMTCLISYWVTLRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVG     71 - 140
TFVALCFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGIIPGLSSIFLPRMNPFVLIDLAGAF    141 - 210
ALCITYMLIEINNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVL    211 - 280
EVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANV    281 - 350
LNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPY    351 - 420
SSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP                                 421 - 461
//

Text Mined References (22)

PMID Year Title
25284286 2015 Zinc transporters ZnT3 and ZnT6 are downregulated in the spinal cords of patients with sporadic amyotrophic lateral sclerosis.
24182552 2014 Novel gene variants predict serum levels of the cytokines IL-18 and IL-1ra in older adults.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22349685 2012 Zinc transporter mRNA levels in Alzheimer's disease postmortem brain.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19759014 2009 Demonstration and characterization of the heterodimerization of ZnT5 and ZnT6 in the early secretory pathway.
19371353 2010 Alterations of zinc transporter proteins ZnT-1, ZnT-4 and ZnT-6 in preclinical Alzheimer's disease brain.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18639746 2008 Abundant expression of zinc transporters in the amyloid plaques of Alzheimer's disease brain.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17971500 2008 Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
17349999 2007 Zinc transporter 2 (SLC30A2) can suppress the vesicular zinc defect of adaptor protein 3-depleted fibroblasts by promoting zinc accumulation in lysosomes.
16580781 2006 Altered expression of zinc transporters-4 and -6 in mild cognitive impairment, early and late Alzheimer's disease brain.
15994300 2005 Two different zinc transport complexes of cation diffusion facilitator proteins localized in the secretory pathway operate to activate alkaline phosphatases in vertebrate cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15154973 2004 In silico identification and expression of SLC30 family genes: an expressed sequence tag data mining strategy for the characterization of zinc transporters' tissue expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997387 2002 Functional characterization of a novel mammalian zinc transporter, ZnT6.