Property Summary

NCBI Gene PubMed Count 22
PubMed Score 32.56
PubTator Score 26.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.200 1.2e-07
astrocytic glioma -1.500 1.6e-02
ependymoma -2.000 1.7e-02
glioblastoma -1.900 7.8e-06
medulloblastoma -1.700 8.1e-05
atypical teratoid / rhabdoid tumor -1.800 1.9e-06
medulloblastoma, large-cell -3.100 4.1e-06
primitive neuroectodermal tumor -1.400 1.6e-03
pancreatic ductal adenocarcinoma liver m... -1.025 1.2e-03
colon cancer -1.500 2.5e-02
lung cancer -1.200 1.1e-02
pediatric high grade glioma -1.400 3.5e-05
ulcerative colitis -1.400 2.1e-04
ovarian cancer -4.100 1.2e-16

Protein-protein Interaction (10)

Gene RIF (18)

PMID Text
23368743 TRPML1 works in concert with ZnT4 to regulate zinc translocation between the cytoplasm and lysosomes.
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of solute carrier family 30 (zinc transporter), member 4 (SLC30A4) in U-937 macrophages
22254085 The loss of ZnT4 in airway inflammation contributes to airway epithelium vulnerability in diseases such as asthma.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19371353 our results suggest that alterations in Zn transport proteins ZnT-1, ZnT-4 and ZnT-6 may contribute to the pathology observed in preclinical Alzheimer's disease subjects before onset of clinical symptoms
19058789 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18639746 Data show that ZNT4 is extensively present in the Abeta-positive plaques in the cortex of human AD brains.
17971500 hZnT-4 is found in the plasma membrane. It is most highly expressed in Molt-4 cells, up-regulated after treatment with phytohemagglutinin & is responsible for the measured decrease of intracellular zinc content after high zinc exposure.
16580781 Our results show that Zn transporter-4 and Zn transporter-6 are significantly (P<0.05) increased in hippocampus/parahippocampal gyrus of early Alzheimer's disease and Alzheimer's disease subjects.
15187159 findings implicate a role for ZnT(4) in mast cell Zn homeostasis and suggest that granule pools of Zn may be distinct from those regulating activation of procaspase-3 and NF-kappaB.
14968438 Decreased hZnT-4 expression is associated with prostate tissue abnormalities independent of total cellular zinc content.
12955079 decreased intensity of ZnT4 immunoreactivity occurred in the progression from benign to invasive localized prostate cancer and to metastatic disease
12743795 The hZnT4 protein did not co-localise with intracellular free zinc pools, suggesting that hZnT4 is not involved in transport of zinc into vesicles destined for secretion into milk.
11988082 hZnT4 is constitutively expressed in the human breast and may be one of the several members of the ZnT family involved in the transport of zinc into milk
11935329 not responsible for acrodermatitis enteropathica in Japanese families
11686514 Genomic localization, organization; exclusion in variants of acrodermatitis enteropathica.

AA Sequence

MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQ      1 - 70
ADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVLYLLFMIGELVGGYIANSLAI     71 - 140
MTDALHMLTDLSAIILTLLALWLSSKSPTKRFTFGFHRLEVLSAMISVLLVYILMGFLLYEAVQRTIHMN    141 - 210
YEINGDIMLITAAVGVAVNVIMGFLLNQSGHRHSHSHSLPSNSPTRGSGCERNHGQDSLAVRAAFVHALG    211 - 280
DLVQSVGVLIAAYIIRFKPEYKIADPICTYVFSLLVAFTTFRIIWDTVVIILEGVPSHLNVDYIKEALMK    281 - 350
IEDVYSVEDLNIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRT    351 - 420
CANCQSSSP                                                                 421 - 429
//

Text Mined References (24)

PMID Year Title
23368743 2013 Zinc-dependent lysosomal enlargement in TRPML1-deficient cells involves MTF-1 transcription factor and ZnT4 (Slc30a4) transporter.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22254085 2011 Apical localization of zinc transporter ZnT4 in human airway epithelial cells and its loss in a murine model of allergic airway inflammation.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19371353 2010 Alterations of zinc transporter proteins ZnT-1, ZnT-4 and ZnT-6 in preclinical Alzheimer's disease brain.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18639746 2008 Abundant expression of zinc transporters in the amyloid plaques of Alzheimer's disease brain.
17971500 2008 Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
17575980 2007 Differential expression of intestinal membrane transporters in cholera patients.
17349999 2007 Zinc transporter 2 (SLC30A2) can suppress the vesicular zinc defect of adaptor protein 3-depleted fibroblasts by promoting zinc accumulation in lysosomes.
16580781 2006 Altered expression of zinc transporters-4 and -6 in mild cognitive impairment, early and late Alzheimer's disease brain.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15187159 2004 Labile zinc and zinc transporter ZnT4 in mast cell granules: role in regulation of caspase activation and NF-kappaB translocation.
14968438 2004 Differential expression of hZnT-4 in human prostate tissues.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12955079 2003 Expression of the zinc transporter ZnT4 is decreased in the progression from early prostate disease to invasive prostate cancer.
12743795 2003 Analysis of zinc transporter, hZnT4 ( Slc30A4), gene expression in a mammary gland disorder leading to reduced zinc secretion into milk.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11511923 2001 Expression pattern, genomic structure and evaluation of the human SLC30A4 gene as a candidate for acrodermatitis enteropathica.
10600821 1999 Cloning, expression, and vesicular localization of zinc transporter Dri 27/ZnT4 in intestinal tissue and cells.
9354792 1997 A novel gene involved in zinc transport is deficient in the lethal milk mouse.