Property Summary

NCBI Gene PubMed Count 20
PubMed Score 37.56
PubTator Score 25.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.244 1.0e-05
primary pancreatic ductal adenocarcinoma -2.155 8.1e-04
intraductal papillary-mucinous adenoma (... -2.700 1.8e-04
intraductal papillary-mucinous carcinoma... -2.400 6.2e-04
intraductal papillary-mucinous neoplasm ... -2.700 3.9e-03
pancreatic cancer -1.900 4.3e-03
Endometriosis -1.740 3.0e-02
ovarian cancer 1.400 6.0e-11
psoriasis -1.300 1.2e-19

Gene RIF (13)

PMID Text
27137936 findings establish that some heterozygous loss of function ZnT2 mutations disrupt zinc binding and zinc permeation, thereby suggesting a haploinsufficiency state for the unaffected WT ZnT2 allele in Transient Neonatal Zinc Deficiency
26293594 Our study indicates that SLC30A2 variants are common in this population, dysregulate Zn management and can lead to breast cell dysfunction.
25618524 Human ZnT2 expression is regulated by MTF-1.
24333596 PRL-R attenuation post-transcriptionally increased ZnT2 abundance and redistributed intracellular Zn pools into lysosomes and mitochondria.
22733820 inactivating ZnT-2 mutations are an underlying basis of TNZD and provide the first evidence for the dominant inheritance of heterozygous ZnT-2 mutations via negative dominance due to homodimer formation.
22364884 Results indicated that -697G>T and 1031A>G polymorphisms in the SLC30A2 gene may be associated with low-milk-zinc in Chinese breastfeeding women.
21462106 Pancreatic release of zinc by acinar cells is through the secretory process and apical membrane and involves transporter ZnT2
19496757 The localization and function of each ZnT2 isoform, was examined.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
17971500 hZnT-2 was not detectable in leukocytes.
17349999 ZnT2 can facilitate vesicular zinc accumulation independently of AP-3 function, and validate the M1 fibroblastoid line as a human cell culture system amenable to the study of vesicular zinc regulation.
17065149 a mutation in SLC30A2 (ZnT-2) may have a role in transient neonatal zinc deficiency

AA Sequence

MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPDSHCDPKKGKA      1 - 70
QRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISGDYEIDGGTMLITSGCAVAVN     71 - 140
IIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFMQSMGVLVAAYILYFKPEYKYVDPICTFVFS    141 - 210
ILVLGTTLTILRDVILVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTD    211 - 280
AQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD                               281 - 323
//

Text Mined References (23)

PMID Year Title
27137936 2016 Molecular Basis of Transient Neonatal Zinc Deficiency: NOVEL ZnT2 MUTATIONS DISRUPTING ZINC BINDING AND PERMEATION.
26293594 2015 Exome Sequencing of SLC30A2 Identifies Novel Loss- and Gain-of-Function Variants Associated with Breast Cell Dysfunction.
25618524 2015 Coordinative modulation of human zinc transporter 2 gene expression through active and suppressive regulators.
25416956 2014 A proteome-scale map of the human interactome network.
24745988 2014 The families of zinc (SLC30 and SLC39) and copper (SLC31) transporters.
24456035 Transient neonatal zinc deficiency due to a new autosomal dominant mutation in gene SLC30A2 (ZnT-2).
24333596 2014 Prolactin receptor attenuation induces zinc pool redistribution through ZnT2 and decreases invasion in MDA-MB-453 breast cancer cells.
22733820 2012 A dominant negative heterozygous G87R mutation in the zinc transporter, ZnT-2 (SLC30A2), results in transient neonatal zinc deficiency.
22364884 2012 Polymorphisms of SLC30A2 and selected perinatal factors associated with low milk zinc in Chinese breastfeeding women.
21462106 2010 Gastrointestinal factors influencing zinc absorption and homeostasis.
19496757 2009 Zinc transporter-2 (ZnT2) variants are localized to distinct subcellular compartments and functionally transport zinc.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17971500 2008 Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
17897319 2007 Integral and associated lysosomal membrane proteins.
17349999 2007 Zinc transporter 2 (SLC30A2) can suppress the vesicular zinc defect of adaptor protein 3-depleted fibroblasts by promoting zinc accumulation in lysosomes.
17065149 2006 Identification of a mutation in SLC30A2 (ZnT-2) in women with low milk zinc concentration that results in transient neonatal zinc deficiency.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8617223 1996 ZnT-2, a mammalian protein that confers resistance to zinc by facilitating vesicular sequestration.