Property Summary

NCBI Gene PubMed Count 22
PubMed Score 124.39
PubTator Score 95.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Obesity 678 0.0 3.0
Osteoarthritis 184 0.0 1.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 5.248 2.6
Insulinoma 24 4.583 2.3

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -2.828 2.0e-02
adrenocortical carcinoma 2.454 9.7e-03
adult high grade glioma -1.200 9.4e-03
Astrocytoma, Pilocytic -1.300 2.8e-04
atypical teratoid / rhabdoid tumor -1.100 3.8e-02
colon cancer -3.700 7.0e-03
ependymoma -1.300 3.7e-02
glioblastoma -1.600 4.8e-03
group 3 medulloblastoma -1.500 8.1e-03
medulloblastoma, large-cell -2.300 1.6e-04
non primary Sjogren syndrome sicca -1.600 1.7e-02
oligodendroglioma -1.200 2.5e-02
ovarian cancer -1.600 8.0e-06
pancreatic ductal adenocarcinoma liver m... -2.226 4.4e-03
psoriasis -2.700 5.2e-36
ulcerative colitis -3.000 3.7e-07

Gene RIF (15)

AA Sequence

MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYIARRPTRGFSA      1 - 70
TYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVGVLGLLVNVVGLLIFQDCAAW     71 - 140
FACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAADPTAPGSDSAVTLRGTSVERKREKGATVFA    141 - 210
NVAGDSFNTQNEPEDMMKKEKKSEALNIRGVLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYID    211 - 280
PSLTVLMVIIILSSAFPLIKETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLH    281 - 350
IKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL    351 - 420
PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYVNRTHF         421 - 485
//

Text Mined References (25)

PMID Year Title