Property Summary

NCBI Gene PubMed Count 122
PubMed Score 110.68
PubTator Score 149.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.400 3.5e-04
osteosarcoma -1.005 4.7e-04
tuberculosis 1.200 1.0e-05
interstitial cystitis -1.200 2.9e-04
lung carcinoma -1.100 2.9e-17
ovarian cancer -1.300 2.4e-04

Gene RIF (116)

PMID Text
26714568 SLC2A9 was associated with a decreased risk of gout in men (HR = 0.67, 95% CI: 0.49-0.91) and women (HR = 0.54, 95% CI: 0.33-0.89.
26607700 GLUT9 gene polymorphism predicts higher risk for cardiovascular diseases in patient diagnosed with hyperuricemia.
26603249 These results indicate that five newly described SNPs in the hURAT1 gene are significantly associated with uric acid level (4-2008-0318 and 4-2011-0277).
26552468 Demonstrate a significant association between rs2231142 in the ABCG2 gene and gout and identified novel SNPs, c.881A>G and c.1002+78G>A, in the SLC2A9 gene that may be associated with gout in a Korean population.
26345926 SLC2A9 and ZNF518B polymorphisms correlate with gout-related metabolic indices in Chinese Tibetan populations
26167684 single nucleotide polymorphisms in the SLC2A9 gene influence SLC2A9 gene expression as well as urinary uric acid excretion.
26125895 The SLC2A9 (rs7660895) and TOX (rs11777927) gene polymorphisms may be associated with formation of intracranial aneurysms, and rs7660895 may be associated with intracranial aneurysms rupture.
25922070 advances our understanding of how hSLC2A9 mediates urate and fructose transport, providing further information for developing pharmacological agents to treat hyperuricemia and related diseases, such as gout, hypertension, and diabetes
25889045 SLC2A9 genetic mutation is involved in renal excretion of uric acid.
25833971 genetic variation in SLC2A9 is associated with serum uric acid concentrations, an important biomarker of renal and cardiovascular disease risk, in Hispanic children
25634581 Case-control study with 1,146 coronary heart disease (CHD) Chinese cases; association between 2 uric acid related SNP rs11722228 in SLC2A9 and rs4148152 in ABCG2 and CHD risk analyzed; no association was observed between rs11722228 and CHD risk; Among subjects who did not consume alcohol, the G allele of rs4148152 showed a moderate protective effect.
25435339 Polymorphism in the GLUT9 gene, a major genetic regulator of serum uric acid levels, interacts with asymmetric dimethylarginine levels in predicting renal disease progression in chronic renal insufficiency patients.
25301104 Serum uric acid level was dose-dependently associated with the T allele of rs734553, a polymorphism in SLC2A9.
25286413 The surface expression, purification and isolation of monomeric protein, and functional analysis of recombinant hGLUT9, is reported.
25283508 SLC2A9 SNPs are associated with serum uric acid levels in Chinese males and females.
25275768 Single-nucleotide polymorphisms (SNP) rs2231137(C9T) and rs2231142 (C9A) of ABCG2 were found in this familial aggregation of Chinese female premenopausal gout.
25268603 Genetic polymorphisms in the urate transporters SLC2A9, SLC22A12 and non-synonymous allelic variants of GLUT9 showed no evidence of the effect on hyperuricemia and gout in the Czech population.
25257975 The hazard ratio for progression to disability in Parkinson's disease patients increased with increasing SLCA9 score.
25209865 data suggest that nuclear receptor family member HNF4alpha contributes to the transcriptional regulation of SLC2A9 isoform 1
25132463 Placental GLUT-9 expression was not correlated with birthweight.
25128519 Gout with uric acid underexcretion is associated with transporter gene SNP related mainly to tubular reabsorption, whereas uric acid normoexcretion is associated only with tubular secretion SNP.
24972010 ERbeta may affect the expression of Glut9 though autophagy
24940677 hypouricemia patient with GLUT9 R380W, a pathogenic mutation of renal hypouricemia type 2
24858040 the p53-SLC2A9 pathway is a novel antioxidant mechanism that uses uric acid to maintain reactive oxygen species homeostasis and prevent accumulation of reactive oxygen species-associated damage that potentially contributes to cancer development.
24821702 Abundant local interactions in the 4p16.1 region suggest functional mechanisms underlying SLC2A9 associations with human serum uric acid.
24805955 tested the association between uric acid, the rs734555 polymorphism of the GLUT9 gene and arterial pressure in a family-based study including 449 individuals in a genetically homogenous population in Southern Italy
24742479 GLUT9 rs734553 polymorphism, which is strongly associated with serum uric acid levels in healthy individuals of the general population with normal renal function, holds a strong predictive power for chronic kidney disease progression.
24723238 protein expression of URAT1 and GLUT9 in renal tissues of patients with uric acid (UA) nephrolithiasis
24643436 Case Report: homozygous splice-site mutation in the SLC2A9 gene resulting in renal hypouricemia and recurrent exercise-induced acute renal failure and posterior reversible encephalopathy syndrome.
24628802 Mutational screening of the SLC2A9 gene is necessary for the diagnosis of iRHUC, and homozygous mutations of the SLC2A9 alleles can cause severe hypouricemia
24516586 When maternal environmental tobacco smoke was considered, fifteen of 135 single nucleotide polymorphism (SNPs) mapping to SLC2A9 and 9 of 59 SNPs in WDR1 gave P values approaching genome-wide significance.
24409316 we found that 2 isoforms of SLC2A9 have unique intra tissue distribution in the human kidney and that the N-terminal amino acids unique to each isoform plays a role in their membrane trafficking and stability.
24397858 a new compound heterozygosity for two distinct missense mutations in the SLC2A9 gene in exercise-induced acute renal failure
24301058 A strong association was found between SLC2A9 gene polymorphisms and SUA in all centers combined (P-values: 1.3 x 10(-31)-5.1 x 10(-23)) and also when stratified by recruitment center; P-values: 1.2 x 10(-14)-1.0 x 10(-5).
24204615 We observed a similar quadratic relationship between SLC2A9 rs6855911 (associated with increasing levels of uric acid) and social phobia when keeping both men and women in the analysis.
24107611 analysis of mutations in genes SLC22A12 and SLC2A9 urate transporter genes in patients with exercise-induced acute kidney injury
24026676 The gene-environment interaction data suggest that SLC2A9-mediated renal uric acid excretion is influenced by intake of simple sugars derived from sugar-sweetened beverages (SSB), with SSB exposure negating the gout risk discrimination of SLC2A9.
23703922 Significant associations were found in SLC2A9 gene SNPs and plasma uric acid levels (rs6449213, P = 3.15 x 10(-12) ).
23361362 The apical sorting signal for human GLUT9b resides in the N-terminus.
23349133 The rs11942223 C allele was associated with an attenuated hyperuricaemic response and increased fractional excretion of uric acid following fructose load. Effects were present only in the Caucasian subgroup, not in Maori and Pacific subgroups.
23302780 study provides the first direct evidence for GLUT9 and GLUT12 expression in vascular smooth muscle cells in conjunction with the previously identified GLUT1 and GLUT10
23272134 fluctuations in uric acid levels among obese patients who underwent bariatric surgery appear to be driven by the weight losses and gains, independent of SLC2A9 genotypes
22753387 When investigating the genes separately, SLC22A11 and SLC2A9 showed a significant interaction, consistent with the former encoding an organic anion/dicarboxylate exchanger, which mediates diuretic transport in the kidney.
22647630 The differential expression pattern of SLC2A9a and SLC2A9b in the kidney's proximal convoluted tubule and its electrogenic transport of urate suggest that these transporters play key roles in the regulation of plasma urate levels
22527535 Our findings suggest that loss-of-function mutations in the SLC2A9 gene cause renal hypouricaemia via loss of uric acid absorption and do lead to acute kidney injury.
22420403 The common SLC2A9 rs1014290 polymorphism was significantly associated with reduced uric acid levels in Chinese female patients with increased risk for coronary heart disease.
22393348 SLC2A9 polymorphisms rs13124007 and rs6850166 are associated with susceptibility to gout in Chinese males
22212408 This study demonstrates that genetic variants in SLC2A9 influence uric acid levels in Korean adults.
22132990 Hyperfunctioning URATv1 in the kidney can lead to increased urate reabsorption and may contribute to the development of hyperuricemia.
22132964 GLUT9 mutations cause renal hypouricemia type 2 (RHUC2) by their decreased urate reabsorption on both sides of the renal proximal tubule cells.
22005930 SNPs upstream of SLC2A9 and within VSNL1 showed strongest evidence for association with AD + P when compared with controls.
21810765 Homozygous SLC2A9 mutations cause renal hypouricemia type 2
21658257 For SLC2A9 we were unable to replicate associations of rs3733591 with gout in Eastern Polynesian, Western Polynesian and Caucasian samples.
21584282 The SNP rs1014290 within the SLC2A9 gene is associated with type 2 DM in Han Chinese.
21536615 GLUT9, unlike URAT1, may play a specific role in exercise-induced PRES.
21511506 the first report to estimate the impact of SLC2A9 rs11722228 on serum uric acid levels.
21294900 Four variants of the gene SLC2A9 achieved genome-wide significance for association with serum uric acid.
21256783 a novel homozygous insertion in exon 3 of the SLC2A9 gene caused renal hypouricemia
21186168 There is a association between SLC2A9 transporter gene variants and uric acid phenotypes in African American and white families.
20972595 the polymorphism rs6855911 in SLC2A9 may have a role in hyperuricemia among the Chinese male Han population
20972595 Observational study of gene-disease association. (HuGE Navigator)
20926839 expression of glucose transporter type 9(GLUT9) isoforms is significantly increased in placental tissue from diabetic pregnancies and may play a role in the fetal pathophysiology associated with diabetes-complicated pregnancies
20884846 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20714133 replicated the associations of the SLC2A9 and ABCG2 polymorphisms with serum UA and clarified the prognostic significance of the SLC22A12, SLC2A9 and ABCG2 genotypes for the development of hyperuricemia
20714133 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20589538 Data suggest that SLC2A9 genetic variants influence age of onset of Parkinson's disease
20589538 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20588307 Results implicate genetic variation in SLC2A9 in influencing levels of serum urate over a broad range of values in a large Mauritian family cohort.
20472486 renal urate transporters SLC2A9 and ABCG2: The risk variants at each gene approximately double the risk for gout in people of Caucasian ancestry, with SLC2A9 also resulting in higher risk for gout in people of Polynesian ancestry
20413573 Results showed that the association between single nucleotide polymorphism in GLUT9 and the development of gout was replicated in Japanese men.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20197412 Significant associations were detected with SLC2A9 and a general memory factor and other individual cognitive ability tests.
20162745 Development of nephrolithiasis may be associated with SLC2A9 gene.
20162745 Observational study of gene-disease association. (HuGE Navigator)
20162744 Three single nucleotide polymorphisms from the SLC2A9 gene were correlated with dietary habits and uric acid.
20162744 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20162743 Observational study of gene-disease association. (HuGE Navigator)
20162742 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20053405 Genetic variants within SLC2A9,ABCG2 and SLC17A3 are associated with uric acid levels
20053405 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19926891 Homozygous loss-of-function mutations of SLC2A9 cause a total defect of uric acid absorption, leading to severe renal hypouricemia complicated by nephrolithiasis and exercise-induced acute renal failure.
19890391 polymorphisms in SLC2A9 and ABCG2 influencing serum uric acid levels contribute to susceptibility to gout, but not to coronary artery disease
19890391 Observational study of gene-disease association. (HuGE Navigator)
19877038 There is a role of SLC2A9 in gout susceptibility in a New Zealand Caucasian sample set and association of SLC2A9 with gout in samples of Maori and Pacific Island ancestry.
19877038 Observational study of gene-disease association. (HuGE Navigator)
19833602 Observational study of gene-disease association. (HuGE Navigator)
19808778 Studies confirm the expression of GLUT9a and GLUT9b in murine and human beta-cells
19797240 GLUT9, which seems to be both a fructose and a uric acid transporter, plays an important role in these conditions associated with hyperuricemia--REVIEW
19723617 Non-synonymous SNP rs3733591 variant within the SLC2A9 gene from two geographically diverse populations(Han Chinese subjects and Solomon Islanders) served as an important genetic checkpoint for tophaceous gout and increased uric acid levels.
19723617 Observational study of gene-disease association. (HuGE Navigator)
19679263 In the SardiNIA study, a GWAS found several SNPs in the GLUT9 gene to be associated with levels of Uric Acid.
19593129 the apical expression of SLC2A9 secretes urate back into the urine in exchange for lumenal glucose and SLC2A9 could be the primary route for urate movement--review
19503597 Meta-analysis of gene-disease association. (HuGE Navigator)
19026395 Mutations in SLC2A9 cause renal hypouricemia.
18842065 Study provides evidence that SLC2A9 splice variants act as high-capacity urate transporters and is one of the first functional characterisations of findings from genome-wide association scans.
18834626 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18759275 GLUT9, which is expressed in the kidney, may be a novel regulator of uric acid elimination and that a common nonsynonymous variant in this gene contributes to abnormalities in uric acid homeostasis and gout.
18759275 Genome-wide association study of gene-disease association. (HuGE Navigator)
18701466 The in vivo role of GLUT9 is supported by the fact that a renal hypouricemia patient without any mutations in SLC22A12 was found to have a missense mutation in SLC2A9, which reduced urate transport activity in vitro.
18606621 Serum uric acid levels and renal uric acid excretion have been found to be modulated by genetic polymorphisms in SLC2A9, a fructose transporter, which can influence the risk for gout by affecting renal urate reabsorption.
18487473 Genetic variants within SLC2A9 have significant effects on uric acid levels and are modified by sex and body mass index.
18487473 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18398472 common genetic variations within the GLUT9 gene strongly influence the risk for gout but are unlikely to have a major effect on coronary artery disease or myocardial infarct in a German population
18398472 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18327257 SLC2A9 variants were associated with low fractional excretion of uric acid and/or gout
18327257 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18327256 Single nucleotide polymorphism in SLC2A9 is associated with Gout
18327256 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18179892 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18177733 GLUT1 and 9 are preferentially localized to the plasma membrane and thus can account for the transport activity.
18172662 GLUT9 expression was studied in normal and degenerate intervertebral discs.
17997608 These results suggest that polymorphisms in GLUT9 could affect glucose metabolism and uric acid synthesis and/or renal reabsorption, influencing serum uric acid levels over a wide range of values.
17997608 Observational study of gene-disease association. (HuGE Navigator)
14739288 alternative splicing alters trafficking
11991658 GLUT9 is expressed by normal articular chondrocytes.

AA Sequence

MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVASLAGAFGSSFL      1 - 70
YGYNLSVVNAPTPYIKAFYNESWERRHGRPIDPDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHT     71 - 140
LLANNGFAISAALLMACSLQAGAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFIC    141 - 210
IGVFTGQLLGLPELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKA    211 - 280
DVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPP    281 - 350
AKIPYVTLSTGGIETLAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTITLTLQDHAPWVPYLSIVGIL    351 - 420
AIIASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICIT    421 - 490
GAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP                        491 - 540
//

Text Mined References (124)

PMID Year Title
26714568 2016 Gout in Older Adults: The Atherosclerosis Risk in Communities Study.
26607700 2015 A genetic marker of hyperuricemia predicts cardiovascular events in a meta-analysis of three cohort studies in high risk patients.
26603249 2015 Discovery of URAT1 SNPs and association between serum uric acid levels and URAT1.
26552468 2015 Genetic analysis of ABCG2 and SLC2A9 gene polymorphisms in gouty arthritis in a Korean population.
26345926 2015 SLC2A9 and ZNF518B polymorphisms correlate with gout-related metabolic indices in Chinese Tibetan populations.
26167684 2015 SLC2A9 Genotype Is Associated with SLC2A9 Gene Expression and Urinary Uric Acid Concentration.
26125895 2015 Intracranial aneurysm risk factor genes: relationship with intracranial aneurysm risk in a Chinese Han population.
25922070 2015 Critical Roles of Two Hydrophobic Residues within Human Glucose Transporter 9 (hSLC2A9) in Substrate Selectivity and Urate Transport.
25889045 2015 An update on the genetic architecture of hyperuricemia and gout.
25833971 2015 Serum uric acid concentrations and SLC2A9 genetic variation in Hispanic children: the Viva La Familia Study.
25634581 2015 Associations of the uric acid related genetic variants in SLC2A9 and ABCG2 loci with coronary heart disease risk.
25435339 2015 Synergism between asymmetric dimethylarginine (ADMA) and a genetic marker of uric acid in CKD progression.
25301104 2015 A genetic marker of uric acid level, carotid atherosclerosis, and arterial stiffness: a family-based study.
25286413 2014 Expression, purification, and structural insights for the human uric acid transporter, GLUT9, using the Xenopus laevis oocytes system.
25283508 2014 Serum uric acid levels are associated with polymorphisms in the SLC2A9, SF1, and GCKR genes in a Chinese population.
25275768 2014 Familial aggregation of a Chinese female premenopausal gout: monogenic, polygenic, or clinical coincidence?
25268603 2014 Complex analysis of urate transporters SLC2A9, SLC22A12 and functional characterization of non-synonymous allelic variants of GLUT9 in the Czech population: no evidence of effect on hyperuricemia and gout.
25257975 2014 Mendelian randomization of serum urate and parkinson disease progression.
25209865 2014 Transcriptional regulation of urate transportosome member SLC2A9 by nuclear receptor HNF4?.
25132463 2015 Increased glucose and placental GLUT-1 in large infants of obese nondiabetic mothers.
25128519 2014 Tubular urate transporter gene polymorphisms differentiate patients with gout who have normal and decreased urinary uric acid excretion.
24972010 2014 Estrogen receptor ? signaling induces autophagy and downregulates Glut9 expression.
24940677 2014 Identification of a hypouricemia patient with SLC2A9 R380W, a pathogenic mutation for renal hypouricemia type 2.
24858040 2015 The uric acid transporter SLC2A9 is a direct target gene of the tumor suppressor p53 contributing to antioxidant defense.
24821702 2014 Abundant local interactions in the 4p16.1 region suggest functional mechanisms underlying SLC2A9 associations with human serum uric acid.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24805955 2014 A polymorphism in the major gene regulating serum uric acid associates with clinic SBP and the white-coat effect in a family-based study.
24742479 2014 Association of a polymorphism in a gene encoding a urate transporter with CKD progression.
24723238 2014 Protein expression of urate transporters in renal tissue of patients with uric acid nephrolithiasis.
24643436 2015 A novel homozygous GLUT9 mutation cause recurrent exercise-induced acute renal failure and posterior reversible encephalopathy syndrome.
24628802 2014 Recurrent exercise-induced acute kidney injury by idiopathic renal hypouricemia with a novel mutation in the SLC2A9 gene and literature review.
24516586 2014 Evidence of gene-environment interaction for two genes on chromosome 4 and environmental tobacco smoke in controlling the risk of nonsyndromic cleft palate.
24513273 2014 A genome-wide association study identifies common variants influencing serum uric acid concentrations in a Chinese population.
24409316 2014 Expression of SLC2A9 isoforms in the kidney and their localization in polarized epithelial cells.
24397858 2014 Recurrent exercise-induced acute renal failure in a young Pakistani man with severe renal hypouricemia and SLC2A9 compound heterozygosity.
24379826 2013 Genome-wide association analysis confirms and extends the association of SLC2A9 with serum uric acid levels to Mexican Americans.
24301058 2014 Replication of the effect of SLC2A9 genetic variation on serum uric acid levels in American Indians.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204615 2013 Associations of serum uric acid and SLC2A9 variant with depressive and anxiety disorders: a population-based study.
24107611 2013 Molecular background of urate transporter genes in patients with exercise-induced acute kidney injury.
24026676 2014 Sugar-sweetened beverage consumption: a risk factor for prevalent gout with SLC2A9 genotype-specific effects on serum urate and risk of gout.
23703922 2013 A genome wide association study of plasma uric acid levels in obese cases and never-overweight controls.
23361362 2013 The apical sorting signal for human GLUT9b resides in the N-terminus.
23349133 2013 Population-specific influence of SLC2A9 genotype on the acute hyperuricaemic response to a fructose load.
23302780 2013 Expression of conventional and novel glucose transporters, GLUT1, -9, -10, and -12, in vascular smooth muscle cells.
23272134 2012 Changes in uric acid levels following bariatric surgery are not associated with SLC2A9 variants in the Swedish Obese Subjects Study.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22753387 2013 A urate gene-by-diuretic interaction and gout risk in participants with hypertension: results from the ARIC study.
22647630 2012 Human SLC2A9a and SLC2A9b isoforms mediate electrogenic transport of urate with different characteristics in the presence of hexoses.
22566634 2012 The genetic architecture of economic and political preferences.
22527535 2012 Acute kidney injury in two children caused by renal hypouricaemia type 2.
22420403 2012 Gender-dependent associations of uric acid levels with a polymorphism in SLC2A9 in Han Chinese patients.
22393348 2012 Polymorphisms in the presumptive promoter region of the SLC2A9 gene are associated with gout in a Chinese male population.
22229870 2012 Genome-wide association of serum uric acid concentration: replication of sequence variants in an island population of the Adriatic coast of Croatia.
22212408 2013 Effects of SLC2A9 variants on uric acid levels in a Korean population.
22132990 2011 Increased expression of SLC2A9 decreases urate excretion from the kidney.
22132964 2011 Pathogenic GLUT9 mutations causing renal hypouricemia type 2 (RHUC2).
22005930 2012 Genome-wide association study of Alzheimer's disease with psychotic symptoms.
21983786 2011 Identification of low-frequency variants associated with gout and serum uric acid levels.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21810765 2012 Two novel homozygous SLC2A9 mutations cause renal hypouricemia type 2.
21658257 2011 The SLC2A9 nonsynonymous Arg265His variant and gout: evidence for a population-specific effect on severity.
21584282 2011 The rs1014290 polymorphism of the SLC2A9 gene is associated with type 2 diabetes mellitus in Han Chinese.
21536615 2011 Recurrent EIARF and PRES with severe renal hypouricemia by compound heterozygous SLC2A9 mutation.
21511506 2011 Significant association of serum uric acid levels with SLC2A9 rs11722228 among a Japanese population.
21294900 2011 A genome-wide association study of serum uric acid in African Americans.
21256783 2011 Novel homozygous insertion in SLC2A9 gene caused renal hypouricemia.
21186168 2011 Association between SLC2A9 transporter gene variants and uric acid phenotypes in African American and white families.
20972595 2011 Association of an intronic SNP of SLC2A9 gene with serum uric acid levels in the Chinese male Han population by high-resolution melting method.
20926839 2011 Asymmetric syncytial expression of GLUT9 splice variants in human term placenta and alterations in diabetic pregnancies.
20884846 2010 Multiple genetic loci influence serum urate levels and their relationship with gout and cardiovascular disease risk factors.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20714133 2010 Association of four genetic loci with uric acid levels and reduced renal function: the J-SHIPP Suita study.
20589538 2011 Variation in the uric acid transporter gene SLC2A9 and its association with AAO of Parkinson's disease.
20588307 2010 Genome-wide scan identifies a quantitative trait locus at 4p15.3 for serum urate.
20472486 2011 The genetic basis of hyperuricaemia and gout.
20413573 2010 Association between GLUT9 and gout in Japanese men.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20197412 2010 Variation in the uric acid transporter gene (SLC2A9) and memory performance.
20162745 2010 Association of nephrolithiasis and gene for glucose transporter type 9 (SLC2A9): study of 145 patients.
20162744 2010 Interactions between genetic variants in glucose transporter type 9 (SLC2A9) and dietary habits in serum uric acid regulation.
20162743 2010 Common variants in SLC17A3 gene affect intra-personal variation in serum uric acid levels in longitudinal time series.
20162742 2010 Predictive value of 8 genetic loci for serum uric acid concentration.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20053405 2010 Sex and age interaction with genetic association of atherogenic uric acid concentrations.
19926891 2010 Homozygous SLC2A9 mutations cause severe renal hypouricemia.
19890391 2009 Common polymorphisms influencing serum uric acid levels contribute to susceptibility to gout, but not to coronary artery disease.
19877038 2009 Role of the urate transporter SLC2A9 gene in susceptibility to gout in New Zealand M?ori, Pacific Island, and Caucasian case-control sample sets.
19833602 2010 Multiple single nucleotide polymorphisms in the human urate transporter 1 (hURAT1) gene are associated with hyperuricaemia in Han Chinese.
19808778 2009 Facilitative glucose transporter 9 expression affects glucose sensing in pancreatic beta-cells.
19797240 2009 Facilitative glucose transporter 9, a unique hexose and urate transporter.
19723617 2010 Associations of a non-synonymous variant in SLC2A9 with gouty arthritis and uric acid levels in Han Chinese subjects and Solomon Islanders.
19679263 2009 Using new tools to define the genetic underpinnings of risky traits associated with coronary artery disease: the SardiNIA study.
19593129 2009 Solute carrier family 2, member 9 and uric acid homeostasis.
19503597 2009 Meta-analysis of 28,141 individuals identifies common variants within five new loci that influence uric acid concentrations.
19260141 2009 Genome-wide association study of biochemical traits in Korcula Island, Croatia.
19026395 2008 Mutations in glucose transporter 9 gene SLC2A9 cause renal hypouricemia.
18842065 2008 SLC2A9 is a high-capacity urate transporter in humans.
18834626 2008 Association of three genetic loci with uric acid concentration and risk of gout: a genome-wide association study.
18759275 2008 Association of a common nonsynonymous variant in GLUT9 with serum uric acid levels in old order amish.
18701466 2008 Plasma urate level is directly regulated by a voltage-driven urate efflux transporter URATv1 (SLC2A9) in humans.
18606621 2008 SLC2A9--a fructose transporter identified as a novel uric acid transporter.
18487473 2008 Sex-specific association of the putative fructose transporter SLC2A9 variants with uric acid levels is modified by BMI.
18398472 2008 Association of common polymorphisms in GLUT9 gene with gout but not with coronary artery disease in a large case-control study.
18327257 2008 SLC2A9 is a newly identified urate transporter influencing serum urate concentration, urate excretion and gout.
18327256 2008 SLC2A9 influences uric acid concentrations with pronounced sex-specific effects.
18179892 2008 Genome-wide association study identifies genes for biomarkers of cardiovascular disease: serum urate and dyslipidemia.
18177733 2008 GLUT1 and GLUT9 as major contributors to glucose influx in HepG2 cells identified by a high sensitivity intramolecular FRET glucose sensor.
18172662 2008 Expression of glucose transporters GLUT-1, GLUT-3, GLUT-9 and HIF-1alpha in normal and degenerate human intervertebral disc.
17997608 2007 The GLUT9 gene is associated with serum uric acid levels in Sardinia and Chianti cohorts.
17710649 A highly conserved hydrophobic motif in the exofacial vestibule of fructose transporting SLC2A proteins acts as a critical determinant of their substrate selectivity.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14739288 2004 Identification and characterization of human glucose transporter-like protein-9 (GLUT9): alternative splicing alters trafficking.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12554125 2003 Molecular characterization and partial cDNA cloning of facilitative glucose transporters expressed in human articular chondrocytes; stimulation of 2-deoxyglucose uptake by IGF-I and elevated MMP-2 secretion by glucose deprivation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991658 2002 Human articular chondrocytes express three facilitative glucose transporter isoforms: GLUT1, GLUT3 and GLUT9.
11739520 2001 Cytokine regulation of facilitated glucose transport in human articular chondrocytes.
10970791 2000 Activity and genomic organization of human glucose transporter 9 (GLUT9), a novel member of the family of sugar-transport facilitators predominantly expressed in brain and leucocytes.
10860667 2000 Cloning and expression analysis of a novel member of the facilitative glucose transporter family, SLC2A9 (GLUT9).