Property Summary

NCBI Gene PubMed Count 15
PubMed Score 34.76
PubTator Score 13.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Placental insufficiency 13 3.0 1.5

Expression

Gene RIF (7)

PMID Text
24519932 GLUT8 is thus essential for hepatocyte fructose transport and fructose-induced macrosteatosis.
23234877 SLC2A8 is upregulated in fast progressing Alzheimer's disease patients, compared to slow progressors.
22452979 Critical roles for novel GLUT family members highlight a therapeutic strategy entailing selective GLUT inhibition to specifically target aberrant glucose metabolism in cancer.
20965718 Observational study of gene-disease association. (HuGE Navigator)
19554504 The expression pattern of GLUT8 is reported in newly diagnosed esophageal adenocarcinoma by means of immunohistochemistry.
16723738 The recruitment of GLUT8 to the endocytic machinery occurs via direct interaction of the dileucine motif with beta2-adaptin, and that endocytosis might be the main site at which GLUT8 is likely to be regulated.
11845330 This carrier protein is expressed in human tissues of the testis in a gonadotropin-dependent manner.

AA Sequence

MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAAS      1 - 70
WFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLV     71 - 140
APVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLL    141 - 210
TQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAE    211 - 280
TIFEEAKFKDSSLASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNS    281 - 350
SHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLM    351 - 420
AFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR                 421 - 477
//

Text Mined References (18)

PMID Year Title
24519932 2014 Glucose transporter 8 (GLUT8) mediates fructose-induced de novo lipogenesis and macrosteatosis.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23234877 2013 Gene expression profiling of peripheral blood leukocytes shows consistent longitudinal downregulation of TOMM40 and upregulation of KIR2DL5A, PLOD1, and SLC2A8 among fast progressors in early Alzheimer's disease.
22452979 2012 Multiple myeloma exhibits novel dependence on GLUT4, GLUT8, and GLUT11: implications for glucose transporter-directed therapy.
21269460 2011 Initial characterization of the human central proteome.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
19554504 2009 Expression of hexokinases and glucose transporters in treated and untreated oesophageal adenocarcinoma.
19176349 2009 GLUT8, the enigmatic intracellular hexose transporter.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17897319 2007 Integral and associated lysosomal membrane proteins.
16723738 2006 Endocytosis of the glucose transporter GLUT8 is mediated by interaction of a dileucine motif with the beta2-adaptin subunit of the AP-2 adaptor complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12554125 2003 Molecular characterization and partial cDNA cloning of facilitative glucose transporters expressed in human articular chondrocytes; stimulation of 2-deoxyglucose uptake by IGF-I and elevated MMP-2 secretion by glucose deprivation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11845330 2002 The glucose transport facilitator GLUT8 is predominantly associated with the acrosomal region of mature spermatozoa.
10821868 2000 GLUT8, a novel member of the sugar transport facilitator family with glucose transport activity.
10671487 2000 GLUTX1, a novel mammalian glucose transporter expressed in the central nervous system and insulin-sensitive tissues.