Property Summary

NCBI Gene PubMed Count 34
PubMed Score 187.90
PubTator Score 113.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.096 1.5e-03
chronic lymphocytic leukemia -1.219 4.4e-04
malignant mesothelioma -2.100 1.3e-05
psoriasis 1.200 4.5e-02
osteosarcoma -3.543 7.0e-10
group 3 medulloblastoma -2.600 6.2e-05
astrocytoma 1.900 1.9e-02
glioblastoma 2.900 8.0e-05
atypical teratoid / rhabdoid tumor -1.500 1.4e-03
medulloblastoma, large-cell -2.300 9.1e-05
primitive neuroectodermal tumor -1.700 3.6e-03
adrenocortical carcinoma -1.424 5.0e-03
tuberculosis and treatment for 3 months -2.200 9.4e-06
non-small cell lung cancer 1.830 1.8e-12
lung cancer 1.100 2.4e-03
diabetes mellitus -1.100 3.6e-02
interstitial cystitis 1.600 4.0e-05
pediatric high grade glioma 1.300 2.4e-03
pilocytic astrocytoma 1.300 6.7e-05
ovarian cancer -3.200 3.6e-12

Protein-protein Interaction (10)

Gene RIF (19)

PMID Text
25326153 SLC2A5-inhibits the human normal adjacent lung adenocarcinoma cytoplasmic pro-B cell development mechanism network.
23910014 SGLT1 and GLUT5 expression in the plasma membrane is regulated by TNFalpha, leading to alteration on sugar transport, suggesting that TNFalpha could be a physiological local regulator of nutrient absorption in response to an intestinal inflammatory status.
23341889 This study determined if single nucleotide polymorphisms in genes involved in fructose transport,SLC2A2 and SLC2A5 and metabolism, etohexokinase affect inter-individual variability in metabolic phenotypes.
23084044 [(99m)Tc]GLA uptake is related to GLUT-5 transporter expression and transport
21938742 In high grade prostatic intraepithelial neoplasia, Glut-1 was immunohistochemically undetectable and Glut-5 localized to the apical portion of the plasma membrane of the hyper-proliferative cells
21165569 A role for the GLUT5 isoform in fructose uptake that takes place in clear renal cell carcinoma cells and which subsequently leads to the malignant progression.
20965718 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20043883 these results suggest that methylation of histone H3 at K4 and acetylation of histones H3 and H4 are involved in SLC2A5 gene induction associated with intestinal differentiation of Caco-2 cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19091748 Slc2a5 (Glut5) is essential for the absorption of fructose in the intestine and generation of fructose-induced hypertension.
18439419 These results suggest that the histone H3 di-methylation at lysine 9, as well as acetylation at lysine 9/14, may be indispensable for coordinated induction of the GLUT5 gene by p44/42 MAP kinase inhibition and the glucocorticoid hormone.
18424253 De-phosphorylation of GR at Ser203 in nuclei associates with GR nuclear translocation and GLUT5 gene expression in Caco-2 cells.
17577579 These results suggest that inactivation of p44/42 MAPK enhances T(3)-induced GLUT5 gene expression in Caco-2 cells through increasing TRalpha-1 transactivity and binding activity to the GLUT5-TRE, probably due to de-phosphorylation of TRalpha-1.
17251278 GLUT5 expression is dramatically increased in diabetic muscle and pioglitazone treatment reverses this overexpression.
16803853 GLUT4 and GLUT12 were predominantly expressed in type I oxidative fibers; however, GLUT5 was expressed predominantly in type II (white) fibers
14757434 Differentiation of THP-1 monocytes into macrophages was associated with marked induction of GLUT 3 and GLUT 5 protein expression, and high levels of GLUT 1, GLUT 3, and GLUT 5 were maintained after transformation to foam cells.
12820898 Fructose modulation of GLUT5 mRNA stability via cyclic AMP-signalling pathway and PABP (polyadenylated-binding protein)-interacting protein (Paip) 2.

AA Sequence

MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLL      1 - 70
WSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAG     71 - 140
VSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLL    141 - 210
PFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLS    211 - 280
IIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFS    281 - 350
ICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW    351 - 420
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEE    421 - 490
LKELPPVTSEQ                                                               491 - 501
//

Text Mined References (38)

PMID Year Title
26319403 2015 Natural Selection at the Brush-Border: Adaptations to Carbohydrate Diets in Humans and Other Mammals.
25326153 2015 Low glucose transporter SLC2A5-inhibited human normal adjacent lung adenocarcinoma cytoplasmic pro-B cell development mechanism network.
23910014 2013 TNF? regulates sugar transporters in the human intestinal epithelial cell line Caco-2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23341889 2013 Impact of genetic polymorphisms of SLC2A2, SLC2A5, and KHK on metabolic phenotypes in hypertensive individuals.
23084044 2012 Is [(99m)Tc]glucarate uptake mediated by fructose transporter GLUT-5?
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21938742 2012 Cellular distribution of Glut-1 and Glut-5 in benign and malignant human prostate tissue.
21165569 2011 Fructose transporter GLUT5 expression in clear renal cell carcinoma.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20043883 2010 Histone H3 methylation at lysine 4 on the SLC2A5 gene in intestinal Caco-2 cells is involved in SLC2A5 expression.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19091748 2009 Slc2a5 (Glut5) is essential for the absorption of fructose in the intestine and generation of fructose-induced hypertension.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18439419 2008 Changes on histone H3 modifications on the GLUT5 gene and its expression in Caco-2 cells co-treated with a p44/42 MAPK inhibitor and glucocorticoid hormone.
18424253 2008 De-phosphorylation of GR at Ser203 in nuclei associates with GR nuclear translocation and GLUT5 gene expression in Caco-2 cells.
17577579 2007 De-phosphorylation of TRalpha-1 by p44/42 MAPK inhibition enhances T(3)-mediated GLUT5 gene expression in the intestinal cell line Caco-2 cells.
17251278 2007 Overexpression of GLUT5 in diabetic muscle is reversed by pioglitazone.
16803853 2006 Hexose transporter mRNAs for GLUT4, GLUT5, and GLUT12 predominate in human muscle.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14757434 Facilitative glucose transporter gene expression in human lymphocytes, monocytes, and macrophages: a role for GLUT isoforms 1, 3, and 5 in the immune response and foam cell formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12820898 2003 Fructose modulates GLUT5 mRNA stability in differentiated Caco-2 cells: role of cAMP-signalling pathway and PABP (polyadenylated-binding protein)-interacting protein (Paip) 2.
12554125 2003 Molecular characterization and partial cDNA cloning of facilitative glucose transporters expressed in human articular chondrocytes; stimulation of 2-deoxyglucose uptake by IGF-I and elevated MMP-2 secretion by glucose deprivation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
11247674 2001 Molecular cloning of a novel member of the GLUT family of transporters, SLC2a10 (GLUT10), localized on chromosome 20q13.1: a candidate gene for NIDDM susceptibility.
9691177 1998 Physical mapping of the CA6, ENO1, and SLC2A5 (GLUT5) genes and reassignment of SLC2A5 to 1p36.2.
8333543 1993 Sequence, tissue distribution, and functional characterization of the rat fructose transporter GLUT5.
8037665 1994 Regulation of expression of the human fructose transporter (GLUT5) by cyclic AMP.
7619085 1995 The GLUT5 hexose transporter is also localized to the basolateral membrane of the human jejunum.
1695905 1990 Human facilitative glucose transporters. Isolation, functional characterization, and gene localization of cDNAs encoding an isoform (GLUT5) expressed in small intestine, kidney, muscle, and adipose tissue and an unusual glucose transporter pseudogene-like sequence (GLUT6).
1634504 1992 Fructose transporter in human spermatozoa and small intestine is GLUT5.
1550217 1992 Human intestinal glucose transporter expression and localization of GLUT5.