Property Summary

NCBI Gene PubMed Count 80
PubMed Score 575.03
PubTator Score 297.42

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (8)

Gene RIF (59)

PMID Text
25919556 Homozygous splice-site mutation IVS8+5G>C (c.1068+5 G>C) of SLC2A2 was found in patient A and homozygous nonsense mutation c.1194T>A (p.Tyr398X) in patient B. Patient C harboured a missense mutation c.380C>A (p.Ala127Asp)
25776730 Three novel variants and seven single-nucleotide polymorphisms associated with the myelomeningocele phenotype.
25711084 SGLT1 or GLUT2 interact with the cytoskeleton in the intestinal epithelium during hexose absorption.
25687571 Data identified the last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC)and the putative tyrosine phosphatase PTPLAD1 as new regulators of Glut2(SLC2A2)translocation in HEK293 cells. SiRNA-mediated knockdown of ATIC delayed insulin response of Glut2 translocation while depletion of PTPLAD1(HACD3} strongly enhanced it in HEK293 cells.
25523092 A novel 6 nucleotide deletion in GLUT2 gene, a member of the facilitative glucose transporter family, is shown to be segregated with Fanconi-Bickel syndrome in an Iranian family.
25165176 Mutations in the GLUT2 gene is associated with ccute metabolic acidosis in Fanconi-Bickel syndrome.
24824030 GLUT-2 expression may be associated with cholangiocarcinogenesis of large bile duct and is a helpful marker for detecting high-grade biliary intraepithelial neoplasia lesions in atypical bile ducts.
24236070 SGLT1 mRNA and GLUT2 mRNA expression are reduced significantly in CACo-2 cells exposed to berry extracts.
23986439 the first gain of function mutations for hGLUT2, revealing the importance of its receptor versus transporter function in pancreatic beta cell development and insulin secretion.
23396969 Intestinal dehydroascorbic acid (DHA) transport is mediated by the facilitative sugar transporters, GLUT2 and GLUT8
23341889 This study determined if single nucleotide polymorphisms in genes involved in fructose transport,SLC2A2 and SLC2A5 and metabolism, etohexokinase affect inter-individual variability in metabolic phenotypes.
23257979 associated with caries risk
23185617 Genetic variant SLC2A2 is marginally associated with risk of cardiovascular disease in type 2 diabetes mellitus patients.
23010768 Case-control analyses revealed a unique association between the G allele of rs9875793 and bipolar disorder patients with 'negative mood delusions' compared with controls.
22993150 GLUT2 gene expression is suppressed in Hepatitis C virus infection via downregulation of HNF-1alpha expression at transcriptional and posttranslational levels.
22865906 Homozygous mutations in GLUT2, which cause Fanconi-Bickel syndrome, can lead to very different clinical and biochemical findings that are not limited to mild proximal renal tubulopathy but can include significant hypercalciuria.
22660720 The finding that patients with homozygous SLC2A2 mutations can have neonatal diabetes supports a role for GLUT2 in the human beta cell.
22350464 Mutation analysis of the GLUT2 gene in three unrelated Egyptian families with Fanconi-Bickel syndrome detected three different mutations.
22221271 enhanced expression of GLUT1 and GLUT2 during differentiation of human embryonic stem cells
22214819 report on two siblings with Fanconi-Bickel syndrome (FBS) and an unusually mild clinical course; both patients were found to be compound heterozygous for the novel GLUT2 (SLC2A2) mutations c.457_462delCTTATA (p.153_4delLI) and c.1250C>G (p.P417R)
22145468 We report the first Chinese cases of Fanconi-Bickel syndrome (FBS),a rare inherited disease caused by mutations in the glucose transporter 2 gene, SLC2A2.
21943636 Constitutive expression of GLUT2 in the apical membrane along with additional translocation of cytoplasmic GLUT2 to the apical membrane via an intact cytoskeleton and activated PKC appears responsible for enhanced carrier-mediated glucose uptake.
21920790 SLC2A1 and SLC2A3 predominate in both human islets and beta-cells their expression level was 2.8 and 2.7 fold higher than SLC2A2 respectively and GLUT2 is therefore unlikely to be the principal glucose transporter in human beta-cells
21852673 In human enterocytes, GLUT2 was consistently located in basolateral membranes; mice on a low-carbohydrate/high-fat diet for 12 months also exhibited endosomal GLUT2 accumulation and reduced glucose absorption.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20564476 Polyphenols, phenolic acids and tannins from strawberry and apple are potent inhibitors of GLUT2 and SGLT1 at concentrations predicted after dietary ingestion.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20419449 Observational study of gene-disease association. (HuGE Navigator)
20201351 Intestinal glucose absorption by the apical GLUT2 pathway can be 3 to 5-times greater then by SGLT1 et the high concentration of sugar.
20142250 prostate cancer was inversely associated with the SLC2A2 rs5400 Thr110 allele
20081858 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20066028 Genetic polymorphisms of SLC2A2 and HP is associated with serum cholesterol levels.
20066028 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19554504 The expression pattern of GLUT2 is reported in newly diagnosed esophageal adenocarcinoma by means of immunohistochemistry.
19303158 HCV replication down-regulates cell surface expression of GLUT2 partly at the transcriptional level, and possibly at the intracellular trafficking level as suggested for GLUT1, thereby lowering glucose uptake by hepatocytes.
19269875 combined presence of rs5393 & rs5394 polymorphisms of GLUT2 was more frequent in type 2 diabetics than non-diabeteics; rs5394 appeared to be associated with decreased glucose stimulated insulin release & a tendency to a reduced GLUT2 gene expression
19269875 Observational study of gene-disease association. (HuGE Navigator)
19223655 The contribution of GLUT2 to human metabolic diseases (Review)
18349384 Our findings show that a genetic variation in GLUT2 is associated with habitual consumption of sugars, suggesting an underlying glucose-sensing mechanism that regulates food intake.
18349384 Observational study of gene-disease association. (HuGE Navigator)
18239936 Data show that glucose transport in human airway epithelial cells in vitro and in vivo utilises GLUT2 transporters, and suggest that these transporters could contribute to glucose uptake/homeostasis in the human airway.
18220613 recent progress in elucidating the transcriptional regulation of GLUT2 in the liver and pancreatic beta-cells and the relevance to type 2 diabetes.[RREVIEW]
17636114 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17204838 kidney of diabetic rats, an initial and transient upregulation of GLUT2 was induced specifically by insulin only.
17192490 Observational study of gene-disease association. (HuGE Navigator)
17141226 identify Glut2 as a GroPIns transporter in mammals, and define a physiologically relevant cell-permeation mechanism
17065357 Observational study of gene-disease association. (HuGE Navigator)
15983230 Observational study of gene-disease association. (HuGE Navigator)
15983230 SNPs of SLC2A2 predict the conversion to diabetes in obese subjects with impaired glucose tolerance.
15009676 We have found GLUT-2 and glucokinase mRNAs in several brain regions, including the ventromedial and arcuate nuclei of the hypothalamus
14614558 Expression is responsible for resistance to alloxan and streptozotocin toxicity.
14551916 Observational study of gene-disease association. (HuGE Navigator)
12017192 Observational study of gene-disease association. (HuGE Navigator)
12017192 polymorphisms at positions -269, -44, or + 103 may affect GLUT2 gene transcription, possibly associated with reduced expression of the GLUT2 gene in NIDDM patients.
11978637 Hepatocyte nuclear factor-1alpha recruits the transcriptional co-activator p300 on the GLUT2 gene promoter.
11810292 mutated in patients with fanconi-Bickel syndrome
11344224 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTI      1 - 70
SYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGDTLGRIKAMLVANILSLVGAL     71 - 140
LMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIAPTALRGALGTFHQLAIVTGILISQIIGLEF    141 - 210
ILGNYDLWHILLGLSGVRAILQSLLLFFCPESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKER    211 - 280
EEASSEQKVSIIQLFTNSSYRQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNM    281 - 350
VFTAVSVFLVEKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW    351 - 420
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFTFFKVPETKGK    421 - 490
SFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV                                        491 - 524
//

Text Mined References (84)

PMID Year Title
25919556 2015 [SLC2A2 gene analysis in three Chinese children with Fanconi-Bickel syndrome].
25776730 2015 Association of facilitated glucose transporter 2 gene variants with the myelomeningocele phenotype.
25711084 2014 [The interaction between SGLT1 or GLUT2 glucose transporter and the cytoskeleton in the enterocyte as well as Caco2 cell during hexose absorption].
25687571 2015 The last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC) plays a central role in insulin signaling and the Golgi/endosomes protein network.
25523092 2015 Segregation of a novel homozygous 6 nucleotide deletion in GLUT2 gene in a Fanconi-Bickel syndrome family.
25165176 2014 Acute metabolic acidosis in a GLUT2-deficient patient with Fanconi-Bickel syndrome: new pathophysiology insights.
24824030 2014 Different expression of glucose transporters in the progression of intrahepatic cholangiocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24236070 2013 Regulation of glucose transporter expression in human intestinal Caco-2 cells following exposure to an anthocyanin-rich berry extract.
23986439 2013 Mutations in SLC2A2 gene reveal hGLUT2 function in pancreatic ? cell development.
23396969 2013 Intestinal dehydroascorbic acid (DHA) transport mediated by the facilitative sugar transporters, GLUT2 and GLUT8.
23341889 2013 Impact of genetic polymorphisms of SLC2A2, SLC2A5, and KHK on metabolic phenotypes in hypertensive individuals.
23257979 2013 Association of GLUT2 and TAS1R2 genotypes with risk for dental caries.
23185617 2012 Genetic variant SLC2A2 [corrected] Is associated with risk of cardiovascular disease – assessing the individual and cumulative effect of 46 type 2 diabetes related genetic variants.
23010768 2012 Genome-wide significant association between a 'negative mood delusions' dimension in bipolar disorder and genetic variation on chromosome 3q26.1.
22993150 2012 Hepatitis C virus infection suppresses GLUT2 gene expression via downregulation of hepatocyte nuclear factor 1?.
22865906 2012 Fanconi-Bickel syndrome and autosomal recessive proximal tubulopathy with hypercalciuria (ARPTH) are allelic variants caused by GLUT2 mutations.
22660720 2012 SLC2A2 mutations can cause neonatal diabetes, suggesting GLUT2 may have a role in human insulin secretion.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22350464 2012 Mutation analysis of the GLUT2 gene in three unrelated Egyptian families with Fanconi-Bickel syndrome: revisited gene atlas for renumbering.
22221271 2012 The expression of the class 1 glucose transporter isoforms in human embryonic stem cells, and the potential use of GLUT2 as a marker for pancreatic progenitor enrichment.
22214819 2012 Fanconi-Bickel syndrome: GLUT2 mutations associated with a mild phenotype.
22145468 2011 Two cases of Fanconi-Bickel syndrome: first report from China with novel mutations of SLC2A2 gene.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21943636 2012 Mechanisms of glucose uptake in intestinal cell lines: role of GLUT2.
21920790 2011 GLUT2 (SLC2A2) is not the principal glucose transporter in human pancreatic beta cells: implications for understanding genetic association signals at this locus.
21852673 2011 GLUT2 accumulation in enterocyte apical and intracellular membranes: a study in morbidly obese human subjects and ob/ob and high fat-fed mice.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20564476 2010 Polyphenols and phenolic acids from strawberry and apple decrease glucose uptake and transport by human intestinal Caco-2 cells.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20419449 2010 Variants at DGKB/TMEM195, ADRA2A, GLIS3 and C2CD4B loci are associated with reduced glucose-stimulated beta cell function in middle-aged Danish people.
20201351 2009 [The important role of GLUT2 in intestinal sugar transport and absorption].
20142250 2010 Diabetes genes and prostate cancer in the Atherosclerosis Risk in Communities study.
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
20066028 2010 Modeling of environmental effects in genome-wide association studies identifies SLC2A2 and HP as novel loci influencing serum cholesterol levels.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19554504 2009 Expression of hexokinases and glucose transporters in treated and untreated oesophageal adenocarcinoma.
19303158 2009 HCV replication suppresses cellular glucose uptake through down-regulation of cell surface expression of glucose transporters.
19269875 2009 Glucose transporter 2 gene polymorphisms and beta-cell function in isolated human pancreatic islets.
19223655 2009 GLUT2 mutations, translocation, and receptor function in diet sugar managing.
18349384 2008 Genetic variant in the glucose transporter type 2 is associated with higher intakes of sugars in two distinct populations.
18239936 2008 Apical and basolateral localisation of GLUT2 transporters in human lung epithelial cells.
18220613 2006 Transcriptional regulation of glucose sensors in pancreatic beta cells and liver.
17636114 2007 Physical activity modifies the effect of SNPs in the SLC2A2 (GLUT2) and ABCC8 (SUR1) genes on the risk of developing type 2 diabetes.
17204838 2007 Insulin but not phlorizin treatment induces a transient increase in GLUT2 gene expression in the kidney of diabetic rats.
17192490 2007 Screening of 134 single nucleotide polymorphisms (SNPs) previously associated with type 2 diabetes replicates association with 12 SNPs in nine genes.
17141226 2006 Molecular characterization of a glycerophosphoinositol transporter in mammalian cells.
17065357 2006 Analysis of 14 candidate genes for diabetic nephropathy on chromosome 3q in European populations: strongest evidence for association with a variant in the promoter region of the adiponectin gene.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15983230 2005 Polymorphisms in the SLC2A2 (GLUT2) gene are associated with the conversion from impaired glucose tolerance to type 2 diabetes: the Finnish Diabetes Prevention Study.
15009676 2004 Expression of glucose transporter isoform GLUT-2 and glucokinase genes in human brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614558 2003 Mechanism underlying resistance of human pancreatic beta cells against toxicity of streptozotocin and alloxan.
14551916 2003 Candidate gene association study in type 2 diabetes indicates a role for genes involved in beta-cell function as well as insulin action.
13480676 1957 [The glucagon problem in glycogenosis].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12017192 2002 Analysis of polymorphism of the GLUT2 promoter in NIDDM patients and its functional consequence to the promoter activity.
11988093 2002 Karyopherin alpha2: a control step of glucose-sensitive gene expression in hepatic cells.
11978637 2002 Hepatocyte nuclear factor-1alpha recruits the transcriptional co-activator p300 on the GLUT2 gene promoter.
11681785 Structural analysis of the GLUT1 facilitative glucose transporter (review).
11592815 Sequence and functional analysis of GLUT10: a glucose transporter in the Type 2 diabetes-linked region of chromosome 20q12-13.1.
11344224 2001 Studies of genetic variability of the glucose transporter 2 promoter in patients with type 2 diabetes mellitus.
11247674 2001 Molecular cloning of a novel member of the GLUT family of transporters, SLC2a10 (GLUT10), localized on chromosome 20q13.1: a candidate gene for NIDDM susceptibility.
11044475 2000 Mutation analysis of the GLUT2 gene in patients with Fanconi-Bickel syndrome.
10987651 1999 A mutation in GLUT2, not in phosphorylase kinase subunits, in hepato-renal glycogenosis with Fanconi syndrome and low phosphorylase kinase activity.
10697967 2000 Mutation analysis of two Japanese patients with Fanconi-Bickel syndrome.
9751501 1998 Different functional domains of GLUT2 glucose transporter are required for glucose affinity and substrate specificity.
9686354 1998 Fanconi-Bickel syndrome--a congenital defect of the liver-type facilitative glucose transporter. SSIEM Award. Society for the Study of Inborn Errors of Metabolism.
9354798 1997 Mutations in GLUT2, the gene for the liver-type glucose transporter, in patients with Fanconi-Bickel syndrome.
9266402 1997 Fanconi-Bickel syndrome presenting in neonatal screening for galactosaemia.
8923459 1996 Transcriptional activation of the GLUT2 gene by the IPF-1/STF-1/IDX-1 homeobox factor.
8626492 1996 Protein kinase A-dependent phosphorylation of GLUT2 in pancreatic beta cells.
8482435 1993 Organization of the human GLUT2 (pancreatic beta-cell and hepatocyte) glucose transporter gene.
8457197 1993 Kinetic analysis of the liver-type (GLUT2) and brain-type (GLUT3) glucose transporters in Xenopus oocytes: substrate specificities and effects of transport inhibitors.
8063045 1994 Variability of the pancreatic islet beta cell/liver (GLUT 2) glucose transporter gene in NIDDM patients.
8027028 1994 A mutation in the Glut2 glucose transporter gene of a diabetic patient abolishes transport activity.
7593639 1995 Human and rat beta cells differ in glucose transporter but not in glucokinase gene expression.
7593414 1995 Sequence variations of the pancreatic islet/liver glucose transporter (GLUT2) gene in Japanese subjects with noninsulin dependent diabetes mellitus.
7589840 1995 Pancreatic islet GLUT2 glucose transporter mRNA and protein expression in humans with and without NIDDM.
3399500 1988 Sequence, tissue distribution, and chromosomal localization of mRNA encoding a human glucose transporter-like protein.
2656669 1989 Cloning and characterization of the major insulin-responsive glucose transporter expressed in human skeletal muscle and other insulin-responsive tissues.
1862003 1991 Dinucleotide repeat polymorphism at the human GLUT2 locus.
1852621 1991 CA repeat polymorphism in the glucose transporter GLUT 2 gene.