Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.53
PubTator Score 5.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.400 4.2e-02
astrocytoma -1.900 4.4e-14
posterior fossa group B ependymoma -4.000 1.3e-10
glioblastoma -2.700 1.2e-03
oligodendroglioma -1.400 6.2e-08
osteosarcoma 1.850 2.7e-03
group 3 medulloblastoma -4.500 3.9e-05
cystic fibrosis 2.162 3.3e-07
atypical teratoid / rhabdoid tumor -3.200 2.2e-06
medulloblastoma, large-cell -5.100 8.0e-05
primitive neuroectodermal tumor -2.500 2.0e-02
Atopic dermatitis -1.100 4.0e-05
pancreatic ductal adenocarcinoma liver m... -1.388 5.1e-03
interstitial cystitis 1.400 2.5e-03
pediatric high grade glioma -2.000 1.8e-03
pilocytic astrocytoma -1.200 1.5e-02
acute myeloid leukemia -1.100 2.1e-02
psoriasis -1.100 7.9e-23
lung carcinoma 1.600 6.4e-26
Pick disease 1.400 5.0e-02

Protein-protein Interaction (3)

Gene RIF (5)

PMID Text
26094765 SLC2A13 is a novel gamma-secretase associated protein that regulates amyloid beta production without affecting Notch cleavage.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19607714 HMIT is primarily a neuronal transporter widely expressed in the rat and human brain, with particularly high levels in the hippocampus and cortex, as shown by immunohistochemistry.
19473719 genetic alterations of TSPAN14, SLC2A13 and PHF20 could play a role in non-small-cell lung cancer promotion
18976975 Knockdown of solute carrier family 2 (facilitated glucose transporter), member 13 (SLC2A13) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGGVGDLERAARR      1 - 70
QFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGGA     71 - 140
LNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVT    141 - 210
INTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILS    211 - 280
QMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSAT    281 - 350
ILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP    351 - 420
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFK    421 - 490
TEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVS    491 - 560
LTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYI    561 - 630
RVKGSNYHLSDNDASDVE                                                        631 - 648
//

Text Mined References (18)

PMID Year Title
26094765 2015 Proton myo-inositol cotransporter is a novel ?-secretase associated protein that regulates A? production without affecting Notch cleavage.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19915576 2009 Genome-wide association study identifies common variants at four loci as genetic risk factors for Parkinson's disease.
19607714 2009 Evaluation of expression and function of the H+/myo-inositol transporter HMIT.
19473719 2010 Identification of genes associated with non-small-cell lung cancer promotion and progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11500374 2001 Identification of a mammalian H(+)-myo-inositol symporter expressed predominantly in the brain.