Property Summary

NCBI Gene PubMed Count 28
PubMed Score 23.63
PubTator Score 37.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -6.200 4.3e-09
psoriasis -1.500 2.0e-05
glioblastoma multiforme 1.900 4.5e-17
posterior fossa group B ependymoma 2.800 2.1e-17
chronic kidney disease 1.200 4.5e-02
pancreatic ductal adenocarcinoma liver m... -2.815 2.9e-03
intraductal papillary-mucinous adenoma (... 1.100 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.400 4.7e-03
colon cancer -1.900 4.3e-02
lung cancer -1.400 3.2e-02
Breast cancer 3.300 4.7e-02
pediatric high grade glioma 1.900 3.2e-07
group 3 medulloblastoma -1.300 3.9e-03
pilocytic astrocytoma 1.500 1.9e-06
subependymal giant cell astrocytoma 2.216 1.3e-02
nasopharyngeal carcinoma -2.000 5.5e-08
spina bifida -1.867 4.4e-02
ductal carcinoma in situ 1.700 2.6e-03
invasive ductal carcinoma 1.500 2.8e-02
ovarian cancer 3.000 2.1e-05
pituitary cancer -2.400 4.1e-06

Protein-protein Interaction (1)

Gene RIF (22)

PMID Text
26376865 GLUT10 deficiency leads to oxidative stress and non-canonical alphavbeta3 integrin-mediated TGFbeta signalling associated with extracellular matrix disarray in arterial tortuosity syndrome skin fibroblasts
25373504 100 ATS patients have been described, and 21 causal mutations have been identified in the SLC2A10 gene. Study expanded the allelic repertoire of SLC2A10 by identifying two novel mutations.
25078964 Two SNPs replicated: the paternal rs2471083-C allele (located near the imprinted KCNK9 gene) and the paternal rs3091869-T allele (located near the SLC2A10 gene) increased BMI equally (beta = 0.11 (SD), P<0.0027)
22001912 Data show that homozygous and compound heterozygous changes found in PLOD1 and SLC2A10 may confer autosomal recessive effects, and three MYH11, ACTA2 and COL3A1 heterozygous variants were considered as putative pathogenic gene alterations.
20735855 Our data demonstrate that genetic polymorphism of the SLC2A10 gene is an independent risk factor for PAD in type 2 diabetes.
20735855 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18818946 Patients of Kurdish origin who display arterial tortuosity associated with skin hyperextensibility, joint hypermobility, and characteristic facial features may carry a novel non-sense mutationin in the SLC2A10 gene.
18774132 analysis of a missense and a recurrent mutation in SLC2A10 gene of patients affected with arterial tortuosity syndrome
18565096 the c.243C>G mutation in the Middle Eastern families may have a common origin and shared ances
16586067 Observational study of gene-disease association. (HuGE Navigator)
16586067 SLC2A10 genetic variations do not appear to be major determinants for type 2 diabetes susceptibility in the Taiwanese population.
16550171 GLUT10 deficiency is associated with upregulation of the TGFbeta pathway in the arterial wall, a finding also observed in Loeys-Dietz syndrome, in which aortic aneurysms associate with arterial tortuosity
16336637 Observational study of gene-disease association. (HuGE Navigator)
16051383 Complex regulatory mechanism of SLC2A10 expression through interaction of multiple transcription factors on basal promotor and prescence of distal repressor sequence suggests fine modulation of GLUT10 levels critical for glucose homeostasis.
15975113 Observational study of gene-disease association. (HuGE Navigator)
15936967 The SLC2A10 gene encodes a glucose transporter and is located on chromosome 20q13, where evidence has been found for linkage to type 2 diabetes (T2D) in multiple studies.
12941788 Observational study of gene-disease association. (HuGE Navigator)
12941788 variation in the coding region of SLC2A10 does not contribute substantially to the pathogenesis of type 2 diabetes
12890477 expression in adipose tissue

AA Sequence

MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALLASLVGGFLID      1 - 70
CYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACCIYVSELVGPRQRGVLVSLYE     71 - 140
AGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSLSLLFLPAGTDETATHKDLIPLQGGEAPKLG    141 - 210
PGRPRYSFLDLFRARDNMRGRTTVGLGLVLFQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVK    211 - 280
VAATLTAMGLVDRAGRRALLLAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQD    281 - 350
SSLPPIPRTNEDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV    351 - 420
SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFLLYGLTAVLGL    421 - 490
GFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAAS                       491 - 541
//

Text Mined References (28)

PMID Year Title
26376865 2015 GLUT10 deficiency leads to oxidative stress and non-canonical ?v?3 integrin-mediated TGF? signalling associated with extracellular matrix disarray in arterial tortuosity syndrome skin fibroblasts.
25373504 2014 Arterial Tortuosity Syndrome: homozygosity for two novel and one recurrent SLC2A10 missense mutations in three families with severe cardiopulmonary complications in infancy and a literature review.
25078964 2014 Novel approach identifies SNPs in SLC2A10 and KCNK9 with evidence for parent-of-origin effect on body mass index.
22001912 2012 Rapid detection of gene mutations responsible for non-syndromic aortic aneurysm and dissection using two different methods: resequencing microarray technology and next-generation sequencing.
20735855 2010 SLC2A10 genetic polymorphism predicts development of peripheral arterial disease in patients with type 2 diabetes. SLC2A10 and PAD in type 2 diabetes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18818946 2009 A novel non-sense mutation in the SLC2A10 gene of an arterial tortuosity syndrome patient of Kurdish origin.
18774132 2009 A novel missense and a recurrent mutation in SLC2A10 gene of patients affected with arterial tortuosity syndrome.
18565096 2008 Identification of a p.Ser81Arg encoding mutation in SLC2A10 gene of arterial tortuosity syndrome patients from 10 Qatari families.
17935213 2008 Arterial tortuosity syndrome: clinical and molecular findings in 12 newly identified families.
16586067 2006 Association study of genetic polymorphisms of SLC2A10 gene and type 2 diabetes in the Taiwanese population.
16550171 2006 Mutations in the facilitative glucose transporter GLUT10 alter angiogenesis and cause arterial tortuosity syndrome.
16336637 2005 Genetic analysis of the GLUT10 glucose transporter (SLC2A10) polymorphisms in Caucasian American type 2 diabetes.
16051383 2005 Functional characterization of the promoter of the human glucose transporter 10 gene.
15975113 2005 Studies of relationships between the GLUT10 Ala206Thr polymorphism and impaired insulin secretion.
15936967 2005 Evaluation of SLC2A10 (GLUT10) as a candidate gene for type 2 diabetes and related traits in Finns.
15679832 2005 A family exhibiting arterial tortuosity syndrome displays homozygosity for markers in the arterial tortuosity locus at chromosome 20q13.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12941788 2003 Genetic variation of the GLUT10 glucose transporter (SLC2A10) and relationships to type 2 diabetes and intermediary traits.
12890477 2003 Expression of Class III facilitative glucose transporter genes (GLUT-10 and GLUT-12) in mouse and human adipose tissues.
12554125 2003 Molecular characterization and partial cDNA cloning of facilitative glucose transporters expressed in human articular chondrocytes; stimulation of 2-deoxyglucose uptake by IGF-I and elevated MMP-2 secretion by glucose deprivation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11592815 Sequence and functional analysis of GLUT10: a glucose transporter in the Type 2 diabetes-linked region of chromosome 20q12-13.1.
11247674 2001 Molecular cloning of a novel member of the GLUT family of transporters, SLC2a10 (GLUT10), localized on chromosome 20q13.1: a candidate gene for NIDDM susceptibility.