Property Summary

NCBI Gene PubMed Count 418
PubMed Score 2531.32
PubTator Score 1866.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung cancer 2798 5.94647658362239E-29
lung carcinoma 2844 1.3274656270122E-12
lung adenocarcinoma 2714 1.75069155498301E-10
ovarian cancer 8492 2.87503473422533E-10
pancreatic cancer 2300 9.68230006249638E-9
lung cancer 4473 7.00628508235813E-7
interstitial cystitis 2299 7.8253014300454E-6
malignant mesothelioma 3163 2.30344678067683E-5
osteosarcoma 7933 9.00074767386519E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.85211635394011E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.48857667504747E-4
ductal carcinoma in situ 1745 6.66773159507424E-4
breast carcinoma 1614 0.0011150541914538
invasive ductal carcinoma 2950 0.00458571218329215
group 3 medulloblastoma 2254 0.00515631281793629
adrenocortical carcinoma 1427 0.00824232555247647
colon cancer 1475 0.0253337771487808
Breast cancer 3099 0.0295920408285383
primary pancreatic ductal adenocarcinoma 1271 0.043816505655696
Disease Target Count
Epilepsy, idiopathic generalized 12 1

Expression

Synonym

Accession P11166 A8K9S6 B2R620 D3DPX0 O75535 Q147X2
Symbols CSE
PED
DYT9
GLUT
DYT17
DYT18
EIG12
GLUT1
HTLVR
GLUT-1
SDCHCN
GLUT1DS

Gene

PDB

1SUK   4PYP   5EQG   5EQH   5EQI  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG

Gene RIF (378)

PMID Text
26746193 identify a downregulation of miR-150 in CD46-costimulated T cells and identify the glucose transporter 1 encoding transcript SLC2A1 as a target of miR-150 regulation
26598494 study highlights the frequency, novel mutations and clinical and molecular spectrum of PRRT2, SLC2A1 and PNKD mutations as well as the phenotype-genotype overlap among these paroxysmal movement disorders.
26573871 The underlying mechanisms were defined that the anticancer effects of apigenin were reversed by ectopic GLUT1 overexpression and galactose supplementation, through activation of pentose phosphate pathway-mediated NADPH generation
26539827 MCT1 and GLUT1 may be potential prognostic markers in adenocarcinoma.
26537434 role of mutations in absence epilepsy with early onset, but not in myoclonic astatic epilepsy
26407611 Ghrelin modulates GLUT1 expression and thus indirectly enhances tumor cell proliferation. These findings are of major relevance, because glucose uptake is assumed to be a promising target for cancer treatment.
26293674 Enhanced GLUT1 expression in melanoma cells favors their metastatic behavior.
26238658 The results suggest that the effects of apigenin on inhibiting xenograft growth and enhancing xenograft radiosensitivity may be associated with suppressing the expression of GLUT-1 via the PI3K/Akt pathway.
26193382 Patients with "classic" GLUT1DS carried all types of SLC2A1 mutations including missense, frameshift, nonsense mutations, and deletions.
26193257 These results indicate SLC2A1 exhibits a pivotal role in tumor growth, metastasis and glucose metabolism.
More...

AA Sequence

MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVA      1 - 70
IFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFV     71 - 140
PMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPES    141 - 210
PRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL    211 - 280
SQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAIL    281 - 350
MTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM    351 - 420
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADS    421 - 490
QV                                                                        491 - 492
//

Text Mined References (433)

PMID Year Title
26746193 2016 CD46 Activation Regulates miR-150-Mediated Control of GLUT1 Expression and Cytokine Secretion in Human CD4+ T Cells.
26598494 2015 The clinical and genetic heterogeneity of paroxysmal dyskinesias.
26573871 2016 Inhibition of glutamine utilization sensitizes lung cancer cells to apigenin-induced apoptosis resulting from metabolic and oxidative stress.
26539827 2015 A Pilot Proteogenomic Study with Data Integration Identifies MCT1 and GLUT1 as Prognostic Markers in Lung Adenocarcinoma.
26537434 2015 The role of SLC2A1 mutations in myoclonic astatic epilepsy and absence epilepsy, and the estimated frequency of GLUT1 deficiency syndrome.
26407611 2016 Ghrelin promotes oral tumor cell proliferation by modifying GLUT1 expression.
26293674 2015 Glucose transporter isoform 1 expression enhances metastasis of malignant melanoma cells.
26238658 2015 Inhibiting GLUT-1 expression and PI3K/Akt signaling using apigenin improves the radiosensitivity of laryngeal carcinoma in vivo.
26193382 2015 From splitting GLUT1 deficiency syndromes to overlapping phenotypes.
26193257 2015 Deregulated SLC2A1 Promotes Tumor Cell Proliferation and Metastasis in Gastric Cancer.
More...