Property Summary

NCBI Gene PubMed Count 418
PubMed Score 2531.32
PubTator Score 1866.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Epilepsy, idiopathic generalized 12 1

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.700 2.3e-05
osteosarcoma -2.902 9.0e-05
adrenocortical carcinoma 1.313 8.2e-03
primary pancreatic ductal adenocarcinoma 1.488 4.4e-02
non-small cell lung cancer 4.271 5.9e-29
intraductal papillary-mucinous carcinoma... 2.500 2.9e-04
intraductal papillary-mucinous neoplasm ... 3.800 5.5e-04
colon cancer 1.300 2.5e-02
lung cancer 5.300 7.0e-07
pancreatic cancer 2.300 9.7e-09
breast carcinoma 1.500 1.1e-03
Breast cancer 2.700 3.0e-02
interstitial cystitis -1.500 7.8e-06
lung adenocarcinoma 2.800 1.8e-10
group 3 medulloblastoma -1.100 5.2e-03
lung carcinoma 1.100 1.3e-12
ductal carcinoma in situ 1.300 6.7e-04
invasive ductal carcinoma 1.300 4.6e-03
ovarian cancer 2.500 2.9e-10

Protein-protein Interaction (6)

Gene RIF (378)

PMID Text
26746193 identify a downregulation of miR-150 in CD46-costimulated T cells and identify the glucose transporter 1 encoding transcript SLC2A1 as a target of miR-150 regulation
26598494 study highlights the frequency, novel mutations and clinical and molecular spectrum of PRRT2, SLC2A1 and PNKD mutations as well as the phenotype-genotype overlap among these paroxysmal movement disorders.
26573871 The underlying mechanisms were defined that the anticancer effects of apigenin were reversed by ectopic GLUT1 overexpression and galactose supplementation, through activation of pentose phosphate pathway-mediated NADPH generation
26539827 MCT1 and GLUT1 may be potential prognostic markers in adenocarcinoma.
26537434 role of mutations in absence epilepsy with early onset, but not in myoclonic astatic epilepsy
26407611 Ghrelin modulates GLUT1 expression and thus indirectly enhances tumor cell proliferation. These findings are of major relevance, because glucose uptake is assumed to be a promising target for cancer treatment.
26293674 Enhanced GLUT1 expression in melanoma cells favors their metastatic behavior.
26238658 The results suggest that the effects of apigenin on inhibiting xenograft growth and enhancing xenograft radiosensitivity may be associated with suppressing the expression of GLUT-1 via the PI3K/Akt pathway.
26193382 Patients with "classic" GLUT1DS carried all types of SLC2A1 mutations including missense, frameshift, nonsense mutations, and deletions.
26193257 These results indicate SLC2A1 exhibits a pivotal role in tumor growth, metastasis and glucose metabolism.
26183839 High expression of GLUT-1 was associated with Gastric Adenocarcinoma.
26092229 GLUT-1 is overexpressed in cutaneous non-melanoma skin cancer. Its expression in squamous cell carcinoma is related to differentiation status, and its expression in basal cell carcinoma is intimately associated with squamous metaplastic areas.
26088884 bypassing the Glut1 transporter seems not to play an important role in ketogenic diet therapy
26050557 Data indicate that the rs710218 polymorphism in the gene coding glucose transporter type 1 (GLUT1) protein is a risk factor for in-stent restenosis (ISR).
26023239 aerobic glycolysis and cell proliferation were down-regulated when GLUT1 gene expression was suppressed in lung adenocarcinoma cell lines with activating EGFR mutations
25982116 Phosphorylation of GLUT1 on S226 regulates glucose transport.
25963717 A strong positive correlation between the mRNA expression levels of HIF-2alpha, CA9, VEGF, GLUT-1 and OPN suggests a specific hypoxia-associated profile of mRNA expression in glioblastoma multiforme
25919356 this study shed light on the structure and functional relationships of GLUT1 in multiple conformational states.
25914049 Results show that a favorable response to ketogenic dietary therapies cannot be explained solely by mutations in SLC2A1
25912843 Glucose transporter 1 expression exhibits a strong correlation with 18F-FDG uptake in cholangiocellular carcinoma tissue, while pyruvate kinase type M2 expression was not associated with fluoro-2-deoxy-d-glucose uptake.
25863229 expression of HIF and GLUT proteins within TSCC appears to be associated with disease stage, grade, and the presence of metastases. Additional studies are needed to evaluate the diagnostic and prognostic uses of these proteins in the treatment of TSCC
25838393 These results indicate that disrupting SLC2A1, LDHA, or other regulators in cancer cell energetics is a very promising approach for new targeted therapies.
25837797 These results suggest that the combined expression of GLUT1 and ACLY could be a more valuable prognostic factor than their individual expression in node-negative patients with NSCLC.
25811313 In colorectal carcinoma, GLUT1 expression was correlated directly with vessel number and budding score.
25766729 The transport of glucose across the cell membrane by glucose transporters (GLUTs) and intracellular phosphorylation by hexokinases (HKs) are the initial steps of the glycolytic pathway.
25701507 rs3820589 in the SLC2A1 gene modulates the risk to diabetic nephropathy in Brazilian patients with inadequate type 1 diabetes control
25596248 GLUT-1 can be used as a novel biomarker for thyroid carcinoma showing thymus-like elements
25594612 GLUT1 polymorphisms have also been considered as candidate risk factors for Diabetic nephropathy due to their being associated with early kidney alterations, and because GLUT1 functions as a glucose transporter in the kidneys.
25532859 GLUT1D is most likely to be found in myoclonic-atonic seizures and in early onset absence epilepsy . The probability of finding GLUT1D in the classical idiopathic generalized epilepsies is very low
25502934 GLUT1 may be part of an AKT1-dependent mechanism allowing cells to survive in low levels of glucose
25492937 pharmacologic activation of Akt in Tregs can induce Glut1, overcoming the effects of Foxp3. Together, these results illustrate the molecular basis behind differential glucose metabolism in Tregs.
25433755 GLUT-1 has emerged as a valuable immunohistochemical marker to distinguish between infantile hemangiomas and other vascular lesions.
25412955 Positive expression of SLC2A1, SLC2A3, and HIF-1alpha genes was noted in 83.9, 82.1, and 71.7% of SCC specimens and in 34.4, 59.4, and 62.5% of laryngeal cancer samples. Higher levels of mRNA/protein for GLUT1 and HIF-1alpha were noted in SCC compared to NCM
25376377 The specificity for IMP3, GLUT-1, and EMA for differentiating malignant mesotheliomas and benign mesothelial proliferations was 100%
25367121 increased surface expression on monocytes from HIV+ persons
25347093 High GLUT-1 Expression is associated with Tumor Aggressiveness in Patients With Clinical Stage I Endometrioid Endometrial Cancer
25339765 Taken together, separate intracellular localizations of GLUT1 and HTLV-1 Env are required for the fusion activity and infectivity of HTLV-1 Env.
25321477 These data show that despite expression of multiple glucose transporters, B-cell acute lymphoblastic leukemia cells are reliant on Glut1 to maintain aerobic glycolysis and anabolic metabolism.
25307508 RSV induced apoptosis in ovarian cancer cells by impairing glucose uptake, a process involving Akt-regulated plasma membrane GLUT1 trafficking.
25306890 Leptin at concentrations used in the study does not change glucose transport into lymphocytes and seems to have no influence on the expression of GLUT1, GLUT3, GLUT4 and and leptin receptors
25227787 5-Fu resistance was associated with the overexpression of Glut1 in colon cancer cells.
25193692 Glut-1 is a potential predictor of survival in patients with osteosarcoma and that glucose metabolism may be negatively associated with angiogenesis.
25187207 Data demonstrate that, although they appear and function in the tumor as bona fide endothelial cells, the GLUT1-positive endothelial cells display properties of facultative stem cells.
25157747 IGF-I is able to regulate fetal growth, through its up-regulation of the GLUT1 glucose transporter protein on the basal membrane of the syncytiotrophoblast.
25132463 Placental basal plasma membrane GLUT-1 expression was positively correlated with birthweight. Syncytiotrophoblast microvillous GLUT-1 expression was not correlated with birthweight.
25125078 PTEN regulates plasma membrane expression of glucose transporter 1 and glucose uptake in thyroid cancer cells.
25121413 Higher GLUT-1 expression was significantly associated with shorter overall survival.
25120770 overexpression of GLUT-1 mRNA may be associated with the resistance to cisplatin of laryngeal carcinoma Hep-2 cells
25056472 Data suggest expression of GLUT1 and p63 (tumor protein p63) is up-regulated progressively in ovarian tumor tissue from benign serous cystadenomas to borderline cystadenomas to cystadenocarcinomas; normal ovarian tissue is negative for both markers.
25022942 This study underscored that focal epilepsy can be caused by SLC2A1 mutations or that focal seizures may present the main type of seizures.
24980293 High expression of GLUT1 is associated with sinonasal and laryngeal small-cell neuroendocrine carcinoma.
24934577 Case Report: enhanced immunoreactivity with glucose transporter-1 (GLUT-1) in a substantial number of cardiac myxoma cells.
24932809 Expression of GLUT1 and GLUT4 in prostate cancer cells were regulated by flavonoids.
24847886 crystal structure of human GLUT1 at 3.2 A resolution
24824604 pathogenic de novo SLC2A1 mutation (p.Gly18Arg) was found in the atypical patient with overlapping symptoms of alternating hemiplegia of childhood and hemiplegic migraine
24824030 Our results suggest that GLUT-1 expression correlates aggressive behavior and poor prognosis, and that GLUT-1 might be a therapeutic target of cholangiocarcinoma.
24817962 Patients with high expression of CD147 alone, GLUT-1 alone or co-expression of CD147 and GLUT-1 showed greater resistance to radiotherapy for squamous cell carcinoma of the uterine cervix.
24745019 The results of GLUT-1 and CAIX expression did not reveal any significant differences between the proteins expression in the primary tumor and the clinicopathological features
24726496 Ezrin is down-regulated in diabetic kidney glomeruli and regulates actin reorganization and glucose uptake via GLUT1
24699711 SLC2A1 overexpression mediated by DERL3 epigenetic loss contributes to the Warburg effect.
24552568 Data suggest that erythrocytes exhibit down-regulation of GLUT1 in adolescents with type 1 diabetes, suggesting the blood-brain barrier may also exhibit down-regulation of GLUT1 (and thus account for cognitive impairment in such patients).
24502553 silencing of GLUT-1 inhibited tumor formation and growth of osteosarcoma cells in vivo.
24483274 GLUT1 is the only energy metabolism transporter associated with generalized epilepsy. This could be because it is the only glucose transporter present in the neurovascular unit and is thus the rate-limiting step in brain glucose transport.
24467213 CTSD, FKBP10, and SLC2A1 are novel genes that participate in the acquisition and maintenance of the adriamycin-resistant phenotype in leukemia cells.
24368212 Low glut-1 expression is associated with poor treatment response in small-cell lung cancer.
24343741 The combination of IMP3 and GLUT1 is most appropriate for distinguishing malignant mesothelioma from reactive mesothelial cells using formalin-fixed, paraffin-embedded sections.
24242681 High Glut1 expression was associated with hematogenous recurrence.
24164300 GLUT-1 expression is remarkably upregulated in epithelial ovarian cancer and predicts a poor overall survival.
24146103 Glut-1 is important in the energy supply of laryngeal CD133+ Hep-2 cells.
23935399 Data suggest that overexpression of HIF-1alpha, GLUT-1, and iNOS may play an important role in gastric cancer progression. GLUT-1 is a potential candidate for predicting patient survival.
23889809 Loss of tumor-suppressive miR-1291 enhanced RCC cell proliferation, migration and invasion through targeting SLC2A1/GLUT1.
23861325 GLUT1 gene expression detected by ELISA and immunohistochemistry is a useful tool to diagnose malignant pleural effusion.
23744486 Data suggest that detection of ductal carcinoma in situ (DCIS) based on marker expression during breast conserving surgery should be possible with a panel of molecular imaging tracers targeting CD44v6, GLUT1, HER2, IGF1-R, and EGFR.
23740044 Implications of aberrant temperature-sensitive glucose transport via the glucose transporter deficiency mutant (GLUT1DS) T295M for the alternate-access and fixed-site transport models.
23720776 Data indicate that GLUT1 and GLUT3 oligomeric states and transport activities are determined by transmembrane helix 9 sequence.
23674658 Studied the usefulness of (18)F-fluorodeoxyglucose FDG-PET/CT and the relationships among the expressions of HIF-1alpha, Glut-1 and VEGF, histological type, other clinical factors and FDG uptake in thymic epithelial tumours.
23661345 GLUT-1/KOC do not differentiate malignant mesotheliomas from pulmonary adenocarcinomas but can be useful in differentiating reactive mesothelial hyperplasia from malignant mesothelioma and lung adenocarcinoma.
23617290 Inhibition of GLUT1 activity and expression can sensitize Cal27 cells to cisplatin treatment in both normoxic and hypoxic conditions.
23615963 It was proposed that resveratrol interacts directly with the human GLUT1 hexose transporter by binding to an endofacial site and that this interaction inhibits the transport of hexoses across the plasma membrane.
23483445 This letter described that Absence of SLC2A1 mutations does not exclude Glut1 deficiency syndrome.
23480298 Data indicate that glucose transporter 1 (GLUT1) rs841853 polymorphism may confer increased susceptibility to type 2 diabetes mellitus (T2DM) in Asians.
23453806 Glucose influx through GLUT1 restores ATP-to-ADP ratios in the short run and ultimately induces TXNIP protein production.
23427181 An undertransmission of SLCA1 haplotype T-A was not significant for genetic association with myelomeningocele.
23359198 A correlation between proliferation and GLUT-1 score in prostate cancer may be the evidence of active glycolytic metabolism in hypoxic regions.
23306390 Two SLC2A1 mutation carriers are found in 26 early onset absence epilepsy patients; no mutations are found in 124 probands. affected by or JAE.
23280796 This study demonistrated that glucose transporter 1 (GLUT1) deficiency causes common idiopathic generalized epilepsies.
23227892 After GLUT-1 knockdown, CDDP treatment resulted in increased apoptosis under hypoxia compared with normoxia in cell lines HSC-2, Ca9-22, SAS. results suggest knockdown of GLUT-1 inhibits sensitization of oral squamous cells to CDDP during hypoxia.
23219802 Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains
23187830 Combined application of GLUT-1, MCT-1, and MCT-4 immunohistochemistry might be useful in differentiating malignant pleural mesothelioma from reactive mesothelial hyperplasia.
23108021 both IMP3 and GLUT-1 are more frequently positive in malignant compared with benign mesothelial processes
23106342 This study confirmed that SLC2A1 mutational analysis should be strongly considered in Early onset absence epilepsy.
23098453 High glut1 expression is associated with vulvar squamous cell carcinoma.
23076555 High GLUT1 expresssion is associated with lung adenocarcinoma invasiveness.
23030583 Decreasing expressions of HIF-1alpha, Bcl-2 and Ki-67 were observed during chemoradiotherapy of recel cancer, whereas GLUT-1 overall was unchanged.
23002041 A risk score model derived from a logistic regression analysis of Glut-1 and EMA immunocytochemistry greatly improves the distinction between malignant mesothelioma from reactive mesothelial hyperplasia cells in individual effusions.
22971162 Data from normally cycling young women suggest that expression of GLUT1 (and insulin receptor) in endometrium is higher in luteal/secretory phase (as compared to follicular phase) and is localized to stromal cells (as compared to epithelial cells).
22961556 Genetic variants of SLC2A1 are associated with nonalcoholic fatty liver disease, and in vitro down-regulation of this gene promotes lipid accumulation
22901702 FDG uptake in malignant melanoma is determined by GLUT-1 and GLUT-3, whereas HK-2 and Ki-67 play no role in FDG uptake of malignant melanoma
22899793 The results of this study findings of the mutation of SLC2A1 gene were negative in patients with alternating hemiplegia of childhood.
22888973 GLUT1 expression does not appear to be associated with 18F-FDG uptake in untreated papillary thyroid carcinoma.
22847606 GLUT1 expression is a predictive and prognostic factor for pathologic complete response and recurrence in rectal cancer patients.
22843905 panel consisting of moderate/strong expression of CA IX, positive HIF-1alpha expression and negative/weak GLUT-1 expression in operative samples and negative/weak ezrin expression in biopsies was associated with 47.5-fold risk of death from this disease
22835601 Glut-1 may regulate MMP-2 and MT1-MMP expression in laryngeal carcinoma.
22829208 Iodine-negative epithelium presented significantly higher immunoreactions for P53 and GLUT 1 in basal, parabasal, and superficial layers, respectively
22814174 description of the first Glut-1 (Glucose transporter type 1 deficiency syndrome) patient in Korea with a novel splice site mutation on the basis of clinical features, deficient glucose uptake and a mutation in the SLC2A1 gene
22813791 Elevated GLUT1 expression was associated with poor prognosis in neuroblastoma. GLUT1 expression tended to be localized to the centers of neuroblastoma cell nests.
22812641 Glut1 deficiency is a genetic metabolic encephalopathy with focal and multifocal seizure types and EEG findings.
22800355 HIF-1alpha may promote the expression of GLUT-1 and VEGF in laryngeal carcinoma, which promotes tumor angiogenesis, invasion, and metastasis.
22795339 genetic association studies in a population in Malaysia: Data suggest that an SNP in SLC2A1 (rs841846; the 26177G allele) is associated with type 2 diabetes but not with diabetic retinopathy in this population.
22707195 A systematic review and meta-analysis shows that XbaI, Enh2 and HaeIII SNPs, but not HpyCH4V SNP, in GLUT1 gene may be genetic susceptibility to diabetic nephropathy.
22704013 This study presented with paroxysmal behavioral disturbance, weakness, ataxia (especially after fasting), and exercise intolerance. Electroencephalogram findings did not correlate with clinical manifestations in mutation of glut-1.
22673619 This study concluded that there is a methylxanthine regulatory site on the external surface of the transporter, which is close but distinguishable from the d-glucose external site of GLUT1.
22663547 assessed how triiodothyronine (T(3)) acutely affects glucose transport and the content of GLUT4, GLUT1, and GLUT3 at the surface of muscle cells, and possible interactions between T(3) and insulin action.
22509097 No overall association between SLC2A1 SNPs and age-related macular degeneration was demonstrated.
22483234 We found consistently stronger immuno-expression of GLUT1 in unfavorable histology Wilms tumors compared to favorable histology Wilms tumors.
22475893 The relationship between glucose transporter-1 (GLUT-1) and vascular endothelial growth factor (VEGF) expression and (18)F-fluorodeoxyglucose uptake in esophageal squamous cell cancer patients, was examined.
22470192 GLUT1 is a key rate-limiting factor in the transport and glucose metabolism in cancer cells. This review presents the current state of knowledge on GLUT1 regulation as well as its utility in the diagnosis and therapy of cancers.
22437877 new GLUT-1 mutation in glucose transporter 1 deficiency syndrome patients
22398711 Overexpression of GLUT-1 may be related to 2-deoxy-2-F18-fluoro-D-glucose uptake in false-positive cervical cancer tissues on PET/CT.
22376167 The occurrence of the BRAF V600E genetic variant was significantly correlated with GLUT1 overexpression
22363641 The relative movement of specific helices and pairs of amino acid residues of Glut1 was analyzed.
22308487 studies reveal the Glut1-mediated metabolic pathway as a critical regulator of HIV-1 infection in human CD4 T cells and thymocytes
22308487 Knockdown of GLUT1 by siRNA in CD4+ T cells inhibits HIV-1 infection under both physiological and atmospheric oxygen conditions
22282645 Our study shows that GLUT1 defects are a rare cause of classic idiopathic generalized epilepsy.
22282454 The present meta-analysis shows consistently increased striatal dopamine synthesis capacity in schizophrenia, with a 14% elevation in patients as compared with healthy controls.
22270867 High GLUT1 is associated with endometrial and breast cancers.
22263435 Glucose transport is shown to be decreased in people who have diabetes compared to normoglycaemic volunteers, whereas the number of glucose transporters is apparently unchanged; however, affinity for binding is increased.
22253523 Data show that GLUT1 expression does not correlates significantly with (18)F-FDG uptake in colorectal adenocarcinoma.
22234467 in placenta, CRH produced locally regulates GLUT1 and GLUT3 expression, CRHR1 and CRHR2-mediated differential regulation of GLUT1 and GLUT3 expression
22228332 Dedifferentiation in thyroid cancer is accompanied by GLUT1 upregulation and increased proliferation.
22221271 enhanced expression of GLUT1 and GLUT2 during differentiation of human embryonic stem cells
22200795 The GLUT1 overexpression status was significantly correlated with gene mutation status, including EGFR and Kras genes
22199327 Carbonic anhydrase IX, hypoxia-inducible factor-1alpha, ezrin and glucose transporter-1 have roles in disease outcome in rectal cancer
22153830 High GLUT1 plus high MCT4 expression indicated an aggressive tumor behavior in adenocarcinomas.
22072148 An elevated GLUT1 expression may be a useful predictor of distant recurrence and poor prognosis in rectal cancer patients after preoperative chemoradiotherapy.
22069254 human islets from T1D predominantly express GLUT1 and, to a much lesser extent, GLUT3 on their surface instead of GLUT2.
22029179 The results suggest that there is no prenatal effect of the fetal GLUT1 XbaI polymorphism on fetal insulin sensitivity, intrauterine fetal glucose supply or fetal growth.
22011817 Mutational analysis of the SLC2A1 gene in Japanese patients with glucose transporter 1 deficiency syndrome.
21987722 IKKbeta induced AKT activity, whereas IKKbeta-driven NF-kappaB transcription was required for GLUT1 surface localization downstream of AKT.
21986508 we investigate and propose a possible link between SLC2A1 and SLC2A4 and the evolution of human brain size
21962875 Apart from the classic GLUT1 phenotype, clinical conditions associated with a deficiency of GLUT1 are highly variable and several atypical variants have been described.
21938742 In high grade prostatic intraepithelial neoplasia, Glut-1 was immunohistochemically undetectable and Glut-5 localized to the apical portion of the plasma membrane of the hyper-proliferative cells
21920790 SLC2A1 and SLC2A3 predominate in both human islets and beta-cells their expression level was 2.8 and 2.7 fold higher than SLC2A2 respectively and GLUT2 is therefore unlikely to be the principal glucose transporter in human beta-cells
21899256 GLUT1 harbors several distinct regulatory binding sites for flavones and tyrphostins
21870331 both MCT1 and CD147, but not MCT4, were associated with GLUT1 and CAIX expression in a large series of invasive breast carcinoma samples
21838819 GLUT1 deficiency should be investigated in individuals with unexplained developmental delay. Epilepsy is not a mandatory symptom.
21832227 Dystonia 9 and dystonia 18 are found to be allelic disorders with GLUT1 phenotypes; SLC2A1 mutations are excluded as a cause of hereditary spastic paraparesis without paroxysmal exercise-induced dyskinesia in this cohort.
21808860 The data suggest that glucose transporter 1 is a valuable immunohistochemical marker that can be used to identify patients for evaluation by positron emission tomography scan.
21791420 stomatin-deficient cryohydrocytosis is associated with mutations in SLC2A1 that cause both loss of glucose transport and a cation leak
21786248 The patients with high-expressed GLUT1 had a worse prognosis than those with low-expressed GLUT1 independently of gender, age, tumor site, stage and differentiation (p=0.026, RR 2.737, 95% CI 1.126-6.651) in stage I-III CRCs.
21707071 SLC2A1/GLUT1, SLC1A3/EAAT1, and SLC1A2/EAAT2 were the main SLC proteins whereas ABCG2/BCRP, ABCB1/MDR1, ABCA2 and ABCA8 were the main ABC quantified in isolated brain microvessels
21697701 GLUT1 expression is positive only in infantile hemangiomas, whereas WT1 positivity is found in all vascular neoplasms and in arteriovenous malformations.
21555602 Diagnosis of GLUT1 deficiency is a strong indication for early use of the ketogenic diet, which may substantially improve outcome of this severe disorder.
21546213 No SLC2A1 mutation was identified in 20 (60.6%) patients tested.
21528061 Results show a significant inverse correlation between GLUT1 expression and Apaf-1 expression in colorectal adenocarcinomas, and patients with GLUT1 expression demonstrate poor overall survival.
21521642 Case Report: diagnosis of a congenital GLUT1-negative hepatic vascular malformation with capillary proliferation.
21475039 expression patterns differ between keratoacanthoma and squamous cell carcinoma
21445818 We failed to detect any SLC2A1 mutations in the 23 patients analyzed, thus excluding mutations of this gene as a frequent cause of classical alternating hemiplegia of childhood.
21442770 Data sugget that a combination of GLUT1 and CAIX immunocytochemical staining can give a higher diagnostic performance.
21438910 Coexpression of high levels of HIF-1alpha and GLUT-1 is significantly correlated with prognosis in oral squamous cell carcinoma patients.
21411785 p16 FISH is a more sensitive and specific test than GLUT-1 immunohistochemical analysis and can be a more reliable ancillary tool to support the diagnosis of mesothelioma.
21395180 GLUT1 may play an important role in tumorigenesis, development, differentiation, lymphatic metastasis and prognosis of human laryngeal squamous cell carcinoma.
21384913 major determinants of ligand binding affinity and cooperativity at the GLUT1 endofacial site
21343253 Findings suggest that GLUT1 mRNA expression is essential for decidualization.
21332301 Data indicate that the SNP Rs710218 is not associated with a higher risk for HCC but rather for HCC progression, potentially via HIF-1alpha mediated increased GLUT1 expression.
21321933 The effect of insulin and IGF-I on GLUT expression and glucose transport in three well-characterized human osteosarcoma cell lines, was determined.
21317389 T helper (Th)type 1, Th2, and Th17 cells express high surface levels of glucose transporter Glut1 and are highly glycolytic; regulatory T cells, in contrast, express low levels of Glut1 and have high lipid oxidation rates.
21306648 Data show that CA9, GLUT1 and LOX mRNA levels were equally and strongly correlated to hypoxic extent in FaDudd, and the same was observed for CA9 and GLUT1, but not LOX, in SCCVII tumors.
21295279 Gain and loss of function in glut1, the Drosophila ortholog, was associated with suppression and enhancement of Tau toxicity resulting in Alzheimer disease.
21294792 GLUT1 mRNA levels were detected by reverse transcription-polymerase chain reaction (RT-PCR) in SurePath(TM) liquid-based cytology bronchial brushing specimens from patients with lung cancer and benign lung disease.
21281236 High GLUT-1 is associated with primary central nervous system diffuse large B-cell lymphoma.
21273616 Weak GLUT1 expression is associated with good radiotherapy response in rectal cancer
21270293 Taken together, these observations indicate that 4F2hc is likely to be involved in GLUT1 stabilization and to contribute to the regulation of not only amino acid but also glucose metabolism.
21206329 GLUT-1 seems to be playing a role in pancreatic tumorigenesis as well as in clear-cell pathogenesis.
21194153 The data suggested a crucial role of Glut1 in the development of the cerebral endothelial cells with BBB properties in vivo.
21135204 A 10 base pair (bp) deletion within intron 9 of Glut1 was genotyped for 457 patients with meningomyelocele (MM) and showed it to be more common in Caucasian MM patients than in Caucasian controls (P = .02).
21109935 The relationship of the expression pattern of GLUT-1 with the localization and morphology of the tumor stroma was analyzed.
21075472 high expression in lung adenocarcinoma is associated with a poor survival
21033220 GLUT1 expression(along with Bcl-xl and EPO) plays a role in promoting self survival of malignant cells under hypoxic conditions of colorectal cancer.
21029693 2-NBDG is taken up and accumulated in breast cancer cells that highly express GLUT-1.
20965718 Observational study of gene-disease association. (HuGE Navigator)
20947823 Increased vascular smooth muscle GLUT1 increased glucose uptake, impairing vascular contractility and accelerating proinflammatory, neutrophil-rich lesion in response to injury, as well as medial hypertrophy.
20937822 WNK1 promotes cell surface expression of glucose transporter GLUT1 by regulating a Tre-2/USP6-BUB2-Cdc16 domain family member 4 (TBC1D4)-Rab8A complex
20854211 Downregulation of Glut-1 inhibited the cellular glucose uptake, growth, and invasion of MG63 osteosarcoma cells in vitro.
20846124 The author searched extensively for the expression and influence of 3 markers included in chronic inflammation and early carcinogenesis, cell cycle regulation and tissue hypoxia: cyclooxygenase-2, p53 gene and glucose transporter-1 protein--REVIEW
20803547 GPC3 plays a role in glucose transport by interacting with GLUT1.
20730618 Observational study of gene-disease association. (HuGE Navigator)
20703861 Glut1 expression correlates significantly with (18)F-FDG uptake in lung neoplasms.
20687207 Glut1 deficiency syndrome may present as an autosomal recessive trait
20679470 this genetic variant of glut1 might favor aggressive phenotypes by modulating the efficiency of cancer cells to recruit glucose and escalate growth rate
20679470 Observational study of gene-disease association. (HuGE Navigator)
20630673 Data show that the phenotype of T295M-associated Glut1 deficiency is not significantly different from that of patients with a deficient 3-OMG uptake, indicating that T295M affects glucose transport at the blood-brain barrier as much as other mutations.
20607826 High expression of GLUT-1 and LDH5, a tetramer of 4 lactate dehydrogenase A subunits, was confirmed by tissue microarray analysis of 249 renal cell carcinoma specimens
20574033 GLUT1 deficiency is an important monogenic cause of absence epilepsies with onset from early childhood to adult life. The phenotypic spectrum of GLUT1 deficiency is considerably greater than previously recognized.
20569445 Intratumoral hypoxia in breast cancer is marked by coordinated expression of such markers as HIF-1alpha, Glut-1, leptin and ObR. The relationships among these proteins can be altered by preoperative chemotherapy.
20540786 SLC2A1 polymorphism was significantly associated with 2-[fluorine-18]-fluoro-2-deoxy-D-glucose-uptake in combination with the apurinic/apyimidinic endonuclease Asp148Glu (T>G) polymorphism in the squamous cell type of non-small-cell lung cancer.
20540786 Observational study of gene-disease association. (HuGE Navigator)
20527231 The overexpression of glut1 may be a useful marker in distinguishing benign endometrial hyperplasia from endometrial intraepithelial neoplasia
20526721 The expression of HIF-1alpha and GLUT1 proteins was increased after CoCl(2)-induced hypoxia in all breast cancer cell lines tested
20512538 GLUT-1 is a candidate as a diagnostic as well as a tissue prognostic marker in gallbladder carcinoma patients.
20428049 GLUT1 and GLUT3 protein expression are indicators of poor prognosis outcome in oral squamous cell carcinoma, probably due to the enhanced glycolytic metabolism of more aggressive neoplastic cells.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20395120 GLU-1 is expressed in peri-necrotic regions of tumors and non-malignant tissues and may be linked to hypoxia.
20382060 All patients with severe Glut-1 deficiency syndrome had severe epilepsy, significant cognitive and motor delay, ataxia, and microcephaly. MRI changes, when present, were of greater severity than are typically associated with missense mutations in SLC2A1.
20375117 Suggest the GLUT1 glucose transporter could play an important role in the development of diabetic nephropathy.
20221955 Molecular analysis of the SLC2A1 gene identified a novel homozygous c1402C>T (p. Arg468Trp) mutation in exon 10 in the index patient
20113375 is a prognostic marker for mucoepidermoid carcinoma of salivary gland
20079187 Abnormal expression of beta-catenin and overexpression of Glut-1 may be the early events in tumorigenesis of endometrioid adenocarcinoma.
20063428 clinical survey indicates that gait disturbances and movement disorders are common in patients with Glut-1 deficiency.
20030103 GLUT-1 expression was positive in all the cases of infantile hemangioma on the face.
19955252 Data show altered mRNA expression of insulin receptor substrate (IRS)-1, IRS-2, glucose transporter (GLUT)-1, GLUT-4 and glycogen synthase kinase-3 isoforms genes in adipose tissue in gestational diabetes mellitus women in comparison to pregnant controls.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19883765 Purification and characterization of human glucose transporters GLUT1 expressed in Pichia pastoris.
19822956 XbaI GLUT1 gene polymorphism is associated with type 2 diabetes with nephropathy.
19822956 Observational study of gene-disease association. (HuGE Navigator)
19819644 GLUT1 expression in the ampulla of vater, extrahepatic bile ducts, and gall bladder carcinomas is associated with some prognostic factors, and GLUT1 expression is associated with a worse prognosis in the patients with gall bladder carcinomas.
19798636 findings suggest GLUT1 deficiency underlies a significant proportion of early-onset absence epilepsy
19709351 GLUT-1 served as a marker indicating that tumors with deep invasion tended to result in a worse prognosis in patients due to either lymph node metastasis, a recurrence of the primary lesion or distant metastasis.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19681047 At physiological glucose, GLUT1 and GLUT3 are the predominant active isoforms in HeLa cells and rat hepatocarcinoma AS-30D tumor cells, respectively.
19655166 Expression of pAkt, GLUT1 and TKTL1 were higher in breast cancer and DCIS than in normal tissue.
19648882 Identified GLUT-1 as an additional marker that will be useful for differentiating thymic carcinoma from type B3 thymoma.
19648108 Results show that 8-aminoadenosine reduces glucose consumption by regulating localization and expression of key glucose transporters GLUT1 and GLUT4.
19630075 2 new mutations (c.998G>A & c.274C>T) resulting in p.R333Q & p.R91W respectively were found in patients with sporadic paroxysmal exercise-induced dyskinesia.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19619276 GLUT1 has a role in hypoxia in colorectal cancer
19587357 Meta-analysis of gene-disease association. (HuGE Navigator)
19569052 Increasing GLUT expression is associated with poor response to chemoradiotherapy in rectal cancer.
19554504 The expression pattern of GLUT1 is reported in newly diagnosed esophageal adenocarcinoma by means of immunohistochemistry.
19536037 study to evaluate the expression of glucose transporters (Gluts) 1 and 3 in Hodgkin and nonHodgkin lymphoma and to assess the association between their expression and the tumor intensity on 18F-fluorodeoxyglucose (FDG) positron emission tomography
19533890 Observational study of gene-disease association. (HuGE Navigator)
19533082 Rosiglitazone significantly increases glucose uptake in wild-type podocytes and this is associated with translocation of GLUT1 to the plasma membrane.
19490621 Osteoarthritis chondrocytes exposed to high glucose were unable to downregulate GLUT-1, thereby accumulating more glucose and producing more reactive oxygen species.
19465749 GLUT1 is a highly promising stage-independent, prognostic marker in adrenocortical carcinoma.
19449892 Helix 9 of Glut1 plays an outer stabilizing role for the inner helical bundle predicted to form the exofacial substrate-binding site.
19434538 In human gastric carcinoma, GLUT1 expression is associated with tumor aggressiveness.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19386788 Report endofacial competitive inhibition of the glucose transporter 1 activity by gossypol.
19366592 Role of Ile(287) in GLUT1 was studied by its replacement with each of the other 19 amino acids. Ile(287) is a key residue for maintaining high glucose affinity and is located at or near the exofacial glucose binding site.
19347605 The XbaIG > T and HaeIIIT > C GLUT1 polymorphisms were investigated in six different Brazilian populations.
19347605 Observational study of genotype prevalence. (HuGE Navigator)
19304421 phenotype of GLUT1-deficiency syndrome [review]
19303158 HCV replication down-regulates cell surface expression of GLUT2 partly at the transcriptional level, and possibly at the intracellular trafficking level as suggested for GLUT1, thereby lowering glucose uptake by hepatocytes.
19292042 The overexpression of Glut1 plays an important role in carcinogenesis and progression of breast carcinoma, and closely correlates with cell proliferation.
19289587 EMA is a better marker than XIAP or GLUT-1 for the diagnosis of malignant mesothelioma
19286567 increased GLUT1 expression levels in hepatocellular cancer cells functionally affect tumorigenicity
19234439 GLUT-1 is expressed in approximately half of the pulmonary neuroendocrine carcinomas and shows a strong correlation with neuroendocrine differentiation/grade
19173807 Standard uptake value of 18F-FDG PET-CT is linearly correlated with the expression of GLUT1, but not with the expression of Ki67.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19166280 role for the glucose transporter 1 (GLUT1) in mediating the observed changes in the dielectric properties of human erythrocyte membranes as determined by dielectric spectroscopy
19152396 Observational study of gene-disease association. (HuGE Navigator)
19142800 HIF-1 alpha and GLUT-1 could cooperate with TGF-beta1, and TGF-beta1 might mediate cross-talk between the inflammatory environment and tumour with a favourable impact on patient survival in colorectal cancer
19085834 Glucose transporter-1 is expressed and has a role in pancreatic carcinogenesis
19020742 lysyl oxidase and glucose transporter-1 expression have roles in prostate cancer progression
19020718 Glut-1 may have a role in progression of oral squamous cell carcinoma
19016655 The C-terminal PDZ-binding motif of Glut1 plays a key role in growth factor regulation of glucose uptake by both allowing GIPC to promote Glut1 trafficking to the cell surface and protecting intracellular Glut1 from lysosomal degradation.
18990414 Deficiency may result in cerebral hypoxia and hyperglycemia.
18987250 Erythrocyte GLUT1 transports alpha and beta sugars with equal avidity in an ATP independent manner.
18981181 analysis of glucose transporter GLUT1 topology and structural dynamics
18973239 The altered GLUT1 mRNA expression in diseased cartilage with significance in osteoarthritis(OA) suggests that reduced GLUT1 may contribute to the failure of OA cartilage repair.
18953257 Apigenin inhibits the GLUT-1 glucose transporter and the phosphoinositide 3-kinase/Akt pathway in human pancreatic cancer cells.
18948400 GLUT1 expression is increased in human ESCs when decidualized in vitro with P(4) and dibutyryl cAMP, suggesting a similar role for P(4) in human endometrium.
18821326 The GLUT1 gene confers susceptibility to diabetic nephropathy in type 2 diabetes patients in the Tunisian population.
18821326 Observational study of gene-disease association. (HuGE Navigator)
18764953 results suggest that glucose transporter Glut-1 expression can significantly discriminate between human malignant melanoma and benign melanocytic nevi
18726700 Expression of GLUT-1 is significantly reduced in low-grade oligodendroglial tumors harboring LOH 1p.
18695903 No relationship between the immunohistochemical expression of Glut-1, -3, Hex I or II and glucose metabolism measured using [18F]FDG-PET in patients with high-grade glioma is observed.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18614966 Functional studies of the T295M mutation causing Glut1 deficiency: glucose efflux preferentially affected by T295M.
18613291 The TAT haplotype of the GLUT1 gene confers susceptibility to T2DM in the Tunisian population.
18613291 Observational study of gene-disease association. (HuGE Navigator)
18577546 co-occurring PED and epilepsy can be due to autosomal dominant heterozygous SLC2A1 mutations, expanding the phenotypic spectrum associated with GLUT1 deficiency and providing a potential new treatment option for this clinical syndrome.
18565734 Expression of GLUT-1 in psoriasis and the relationship between GLUT-1 upregulation induced by hypoxia and proliferation of keratinocyte growth.
18451999 GLUT1 mutations are a cause of paroxysmal exertion-induced dyskinesias and induce hemolytic anemia by a cation leak
18422279 Glut1 and HIF-1 alpha are highly expressed in non-small cell lung carcinoma, and their expressions are associated with tumor differentiation and clinical stage.
18410529 Data suggest that resistin causes activation of the ERK1 and 2 pathways in trophoblast cells, and that ERK1/2 activation stimulates GLUT-1 synthesis and increased placental glucose uptake.
18401196 GLUT-1 gene expression level and protein expression were correlated with lymph node metastasis, poor survival and clinical stage of head and neck carcinoma.
18387950 intracellular charges at the MFS TM2-3 and TM8-9 signature loops and flanking TMs 3, 5, and 6 are critical for the structure of GLUT1 as are TM glycines
18351386 Upregulation of HIF-1 alpha and its downstream targets GLUT1 and SDF-1 in colorectal adenomas and carcinomas may be due to hypoxia.
18343752 Glut 1 expression levels in tumor cell lines corresponds to 2-gluSNAP cytotoxicity.
18324916 In the ampulla of Vater, GLUT1 expression was associated with malignant change, and might be a useful marker of malignancy.
18311082 GLUT-1 XbaI gene polymorphism is associated with vascular calcifications in nondiabetic uremic patients.
18311082 Observational study of gene-disease association. (HuGE Navigator)
18290322 A role for GLUT1 as an endogenous marker of tumor hypoxia is currently not supported by the available clinical data.
18271924 the expression of Glut 1 with (18)F-FDG [(18)F]-2-fluro-2-deoxy-D-glucose uptake, indicating that Glut 1 is a major glucose transporter expressed inCholangiocellular carcinoma
18246802 Abnormal expression of GLUT-1, p63 and DNA-Pkcs may perhaps participate in serous ovarian tumor occurrence.
18245775 helix 6 of Glut1 contains amino acid side chains that are critical for transport activity and structurally analogous outer helices may play distinct roles in the function of membrane transporters
18227718 in 5 cases of follicular dendritic cell sarcoma, study found diffuse intense positivity of the tumor cells for Glut-1 in all 5 cases and focal and weak immunoreaction for Claudin-1 in 3 cases
18212354 Observational study of gene-disease association. (HuGE Navigator)
18212354 single nucleotide polymorphisms on gene involved with glucose metabolism and obesity may be associated with increased susceptibility to spina bifida
18191496 Glut-1 plays a crucial role in determining FDG uptake in neuroendocrine (NE) lung tumors
18177733 GLUT1 and 9 are preferentially localized to the plasma membrane and thus can account for the transport activity.
18172662 GLUT1 expression was studied in normal and degenerate intervertebral discs.
18097583 GLUT-1 overexpression is to some extent regulated by HIF-1alpha and is also strongly associated with histological features.
17991316 The positive rate of GLUT-1 was significantly higher in malignant and borderline serous ovarian carcinomas than in benign tumors and normal ovarian tissues.
17854396 Papillary thyroid cancers Papillary thyroid cancers with no 131I uptake had slightly reduced NIS, significantly reduced thyroglobulin,thyroperoxidase and pendrin and significantly increased GLUT-1 gene expression levels.
17727838 Gatifloxacin affects GLUT1 gene transcription, reduces GLUT1 mRNA expression and glucose transport in HepG2 cells. This may contribute to gatifloxacin induced dysglycemia especially in patients predisposed to disturbances of glycemic control.
17635959 Transport regulation involves ATP-dependent conformational changes in (or interactions between) the GLUT1 C terminus and the C-terminal half of GLUT1 cytoplasmic loop 6-7.
17611657 Findings suggest that characteristic differences in the patterns of glucose uptake can exist according to the histological type and that GLUT1, GLUT3 and GLUT4 could be related to tumor angiogenesis in epithelial ovarian carcinoma.
17591274 Observational study of genotype prevalence. (HuGE Navigator)
17554865 The expression of Glut1 changes according to the metabolic need of infantile hemangioma cells.
17504522 Glut-1 is induced by TCR engagement, resulting in massive increases in glucose uptake and binding of HTLV-1 and -2 envelopes to both CD4 and CD8 T lymphocytes
17452775 The role of protein expression of hypoxia-inducible factor (HIF)-1alpha, HIF-2alpha, carbonic anhydrase 9 (CA9) and glucose transporter 1 (GLUT1) in patients with colorectal adenocarcinomas.
17451637 glycosylation change & decrease of transport activity of GLUT1 may be 1 possible mechanism of ER stress induced by down-regulating GnT-V, & GnT-V may contribute to the regulation of glucose uptake by modifying glycosylation of GLUT1 in some tumor cells.
17442736 During trophoblast hypoxia glucose transporters (GLUT1/3) are upregulated via HIF-1 alpha pathway.
17404017 Significant coexpression of GLUT-1, Bcl-xL, and Bax points to cooperation of all three regulatory proteins in elimination due to irreversible injury, adaptation to hypoxia, reduction of further damage, and survival of colorectal cancer cells.
17387384 comparison of the expression of HIF-1alpha and GLUT-1 with various clinicopathological features of colorectal cancer
17294670 GLUT-1 expression have a role in gastric carcinoma, as shown by FDG uptake representing tumor metabolism
17192790 GLUT-1 is a sensitive and specific immunohistochemical marker enabling differential diagnosis of reactive mesothelium from malignant mesothelioma.
17167225 Icreased GLUT1 levels lead to excess glucose metabolism under normoglycemic conditions and altered gene expression of pathogenetic factors involved in diabetic kidney disease.
17080242 The central part of the colorectal tumor, thought to be relatively hypoxic, had stronger GLUT-1 expression and a higher SUV than the periphery, in both the primary tumor and hepatic metastatic foci.
17071132 GLUT1 expression may provide useful prognostic information in patients with salivary gland carcinoma
17064664 GLUT1 may be a major pathway uptake of both inorganic and methylated arsenicals in erythrocytes or the epithelial cells of the blood-brain barrier, contributing to arsenic-related cardiovascular problems and neurotoxicity.
17020877 helix 12 of Glut1 plays a passive stabilizing role in the structure of Glut1 and is not directly involved in the transport mechanism
16842248 GLUT1 is expressed in the vast majority of endometrial intraepithelial and uterine serous papillary carcinoma, suggesting a biological role during the early steps of carcinogenesis in endometrial serous neoplasms.
16800634 Some detergents stabilize while others destabilize GLUT1 quaternary structure but GLUT1 does not appear to exchange rapidly between protein/lipid/detergent micelles.
16681688 In keratinizing carcinomas, GLUT1 was immunodetected peripherally, with loss of expression in central keratinized zones.
16681687 Altered expression of GLUT1 was found in head and neck squamous intraepithelial neoplasia.
16519917 results demonstrate the utilization of cell surface GLUT-1 in HTLV-1 infection of CD4(+) T lymphocytes and implicate a critical role for the ECL1 region in viral tropism
16443776 SGK1 regulates GLUT1 and may contribute to or account for the PI3 kinase-dependent but PKB-independent stimulation of GLUT1 by insulin.
16407180 Data suggest that endocyclic hexose hydrogens, as with maltosaccharides in maltoporins, form pi-bonds with aromatic rings and slide between sites instead of being translocated via a single alternating site in GLUT1.
16310037 basal membrane fractions GLUT1 was positively correlated with birth weight at high, but not low altitude
16273245 GLUT-1 may play an important role in the advancement of papillary carcinoma and lymph node metastasis.
16220828 The GLUT-1 expression in borderline and malignant ovarian epithelial tumors was analyzed against prognosis, no statistically significant difference was identified.
16195374 Glut1 has a role in vitamin C entry into mitochondria and confers mitochondrial protection against oxidative injury
16172126 the exoplasmic end of helix 4 lies outside the inner helical bundle in the exofacial configuration of Glut1
16147855 GLUT1 may play a role in cementogenesis
16142350 HIF-1alpha may have a role in recurrence and survival in superficial bladder cancer, while Glut-1 may have a role in survival in invasive bladder cancer
16136514 This review presents a model incorporating hypoxia responsive facilitative GLUT1 and GLUT3 as putative components of the glucose sensing apparatus in chondrocytes
16126902 during human thymopoiesis, GLUT1 is up-regulated after beta-selection
16125330 We present an alternative hypothesis centring on presumed deficits in membrane bound glucose transporter proteins GLUT 1 and GLUT 3, either in absolute numbers or functional capacity.
15967114 Glut-1, HK-II, and PCNA expression are related to uptake of 18F-FDG uptake in lung cancer
15955807 distinct domains of the glucose transporter GLUT1 mediate HTLV envelope binding and virus entry
15924676 bFGF and GLUT1 play important roles in the carcinogenesis and progression of ovarian epithelial carcinoma.
15847702 CA IX and GLUT 1 as well as VEGF and IL 6 have roles in response of in head and neck squamous cell carcinoma to radiotherapy +/- chemotherapy
15823019 operational properties of GLUT1 are determined by host cell environment
15778389 it is reported in this study that TGF-beta induces binding of HTLV virions and expression of glucose transporter type 1 in primary CD4(+) T lymphocytes that remain quiescent
15767416 results provide additional evidence that glut-1 is a receptor for HTLV
15745834 Observational study of gene-disease association. (HuGE Navigator)
15745834 Oolymorphisms in the GLUT1 gene are associated with susceptibility to diabetic nephropathy.
15709778 Data support a GluT1-mediated red blood cell sugar transport mechanism in which newly bound sugars are transiently sequestered within the translocation pathway where they become inaccessible to extra- and intracellular water.
15682272 Meta-analysis of gene-disease association. (HuGE Navigator)
15502921 Levels of GLUT1 mRNA expression in skin fibroblasts from "slow-track" patients were greater than those from "fast-track" patients with diabetic nephropathy.
15454279 Basal or stimulated ROS production and Glut1 activity were significantly reduced by pretreating both cell lines with EUK-134
15331928 High GLUT1 mRNA levels were observed only in ovarian cancer. The intensity of GLUT1 expression in malignant ovarian neoplasms was associated neither with tumor characteristics nor with patient survival.
15147968 hnRNP A2 acts on GLUT1 mRNA to inhibit expression of GLUT1 in a brain cancer cell line.
15086844 Glut1 is a useful marker of intraneural perineurioma
15073187 Relative proximity and orientation of helices 4 and 8 of the GLUT1 glucose transporter
14991538 There are two fundamentally different hepatic vascular lesions in infants and young children: GLUT1-positive hepatic infantile hemangioma (HIH) and GLUT1-negative hepatic vascular malformation with capillary proliferation (HVMCP).
14757434 Differentiation of THP-1 monocytes into macrophages was associated with marked induction of GLUT 3 and GLUT 5 protein expression, and high levels of GLUT 1, GLUT 3, and GLUT 5 were maintained after transformation to foam cells.
14688257 description of two-dimensional models for the orientation of the 12 transmembrane helices and the conformation of the exofacial glucose binding site of GLUT1
14674124 differences in GLUT1 receptor mRNA expression in two breast cancer cell lines with higher expression in MDA-MB-231; results show that invasiveness of cancer cells may be associated with the expression of glucose transporters, including GLUT1
14622599 GLUT-1 is a receptor for HTLV
12969152 Overexpression of GLUT1 leads to cytosolic alkalinization of mesangial cells depending on functional Na+/H+ exchanger but not on Na+ independent H+ transport.
12942120 increased GLUT-1 expression in rectal tumours was an adverse prognostic factor
12849991 Data show that by using RNA interference, glucose transporter 1 (GLUT1) mRNA and protein expression is reduced, leading to inhibition of a serum-mediated increase in glucose transport.
12752470 To characterize seizure types and electroencephalographic features of glucose transporter type 1 deficiency syndrome (Glut-1 DS).
12583599 Basal membrane GLUT1 is upregulated over gestation, increased in diabetic pregnancy, and decreased in chronic hypoxia, while microvillous membrane GLUT1 is unaffected. (review)
12393496 HTLV receptor expression is an early marker of T-cell cell-cycle entry. Up-regulation of the HTLV receptor, via signals transmitted through the IL-7 cytokine receptor & the TCR, may contribute to mother-to-infant transmission & spreading of HTLV-1.
12379106 TNP-ATP binding to glucose transporter GLUT1 has been modeled as a cooperative process in which each GLUT1 protein in a complex of four proteins (subunits) presents a single nucleotide binding domain.
12379105 Cooperative nucleotide binding to GLUT1 and nucleotide modulation of GLUT1-mediated sugar transport are regulated by a proton-sensitive saltbridge (Glu329-Arg333/334).
12145475 The expression of the glucose transporter 1 was downregulated by up to 80% in the failing heart.
12133004 Results describe a possible non-genomic site of estrogen action near the hydrophilic pore of GLUT1.
12122099 Coexpression of glucose transporter 1 and matrix metalloproteinase-2 in human cancers
12112827 glucose transporter 1 and 3 in the placenta
12086959 Observational study of gene-disease association. (HuGE Navigator)
12086959 polymorphism has an effect on susceptibility to diabetic nephropathy in IDDM
12064911 observed differential response of individual isoforms GLUT1, GLUT3, & GLUT4 in neutrophils and granulocytes to hypoglycemia may represent a mechanism to protect the cells from the stress of glucose deprivation
11991658 GLUT1 is expressed by normal articular chondrocytes.
11953883 Carcinoma samples displaying reduced levels of MCT1 were found to express the high affinity glucose transporter, GLUT1, suggesting that there is a switch from butyrate to glucose as an energy source in colonic epithelia during transition to malignancy
11920478 consistent marker of ovarian epithelial malignancy
11836704 marker for discriminating hepatocellular carcinoma from other carcinomas
11747430 GLUT1 is a cooperative tetramer of proteins, each presenting a translocation pathway that alternates between uptake and export states in which, at any instant, two subunits must present sugar uptake and two subunits must present sugar exit states.
11681785 Review: structure of the human erythrocyte facilitative glucose transporter (GLUT1)
11477169 Observational study of gene-disease association. (HuGE Navigator)
11425315 GLUT1 mediates the transport of glucose across the plasma membrane down a concentration gradient without a specifc requirement for energy or hydrolysis of ATP, however, the ATP-binding domains are critical for transporter activity and kinetic properties.
11231353 Observational study of gene-disease association. (HuGE Navigator)
11168944 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVA      1 - 70
IFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFV     71 - 140
PMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPES    141 - 210
PRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL    211 - 280
SQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAIL    281 - 350
MTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM    351 - 420
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADS    421 - 490
QV                                                                        491 - 492
//

Text Mined References (433)

PMID Year Title
26746193 2016 CD46 Activation Regulates miR-150-Mediated Control of GLUT1 Expression and Cytokine Secretion in Human CD4+ T Cells.
26598494 2015 The clinical and genetic heterogeneity of paroxysmal dyskinesias.
26573871 2016 Inhibition of glutamine utilization sensitizes lung cancer cells to apigenin-induced apoptosis resulting from metabolic and oxidative stress.
26539827 2015 A Pilot Proteogenomic Study with Data Integration Identifies MCT1 and GLUT1 as Prognostic Markers in Lung Adenocarcinoma.
26537434 2015 The role of SLC2A1 mutations in myoclonic astatic epilepsy and absence epilepsy, and the estimated frequency of GLUT1 deficiency syndrome.
26407611 2016 Ghrelin promotes oral tumor cell proliferation by modifying GLUT1 expression.
26293674 2015 Glucose transporter isoform 1 expression enhances metastasis of malignant melanoma cells.
26238658 2015 Inhibiting GLUT-1 expression and PI3K/Akt signaling using apigenin improves the radiosensitivity of laryngeal carcinoma in vivo.
26193382 2015 From splitting GLUT1 deficiency syndromes to overlapping phenotypes.
26193257 2015 Deregulated SLC2A1 Promotes Tumor Cell Proliferation and Metastasis in Gastric Cancer.
26183839 2015 Both GLUT-1 and GLUT-14 are Independent Prognostic Factors in Gastric Adenocarcinoma.
26092229 2015 GLUT-1 Expression in Cutaneous Basal and Squamous Cell Carcinomas.
26088884 2015 Do Glut1 (glucose transporter type 1) defects exist in epilepsy patients responding to a ketogenic diet?
26050557 2015 Functional polymorphism rs710218 in the gene coding GLUT1 protein is associated with in-stent restenosis.
26023239 2015 Signaling through the Phosphatidylinositol 3-Kinase (PI3K)/Mammalian Target of Rapamycin (mTOR) Axis Is Responsible for Aerobic Glycolysis mediated by Glucose Transporter in Epidermal Growth Factor Receptor (EGFR)-mutated Lung Adenocarcinoma.
25982116 2015 A Protein Kinase C Phosphorylation Motif in GLUT1 Affects Glucose Transport and is Mutated in GLUT1 Deficiency Syndrome.
25963717 2015 mRNA expression levels of hypoxia-induced and stem cell-associated genes in human glioblastoma.
25919356 2015 Molecular Dynamics Simulations of the Human Glucose Transporter GLUT1.
25914049 2015 Favourable response to ketogenic dietary therapies: undiagnosed glucose 1 transporter deficiency syndrome is only one factor.
25912843 2015 Relationship between 18-F-fluoro-deoxy-D-glucose uptake and expression of glucose transporter 1 and pyruvate kinase M2 in intrahepatic cholangiocarcinoma.
25863229 2015 Distribution of Hypoxia-Inducible Factor-1? and Glucose Transporter-1 in Human Tongue Cancers.
25838393 2015 Molecular Pathways: Targeting Cellular Energy Metabolism in Cancer via Inhibition of SLC2A1 and LDHA.
25837797 2015 Prognostic impact of the combination of glucose transporter 1 and ATP citrate lyase in node-negative patients with non-small lung cancer.
25811313 2015 Inter- and intra-tumoral relationships between vasculature characteristics, GLUT1 and budding in colorectal carcinoma.
25766729 2016 High 18F-FDG uptake in PMAH correlated with normal expression of Glut1, HK1, HK2, and HK3.
25701507 2015 Association of single nucleotide polymorphisms in the gene encoding GLUT1 and diabetic nephropathy in Brazilian patients with type 1 diabetes mellitus.
25596248 2015 Thyroid carcinoma showing thymus-like elements: a clinicopathologic, immunohistochemical, ultrastructural, and molecular analysis.
25594612 2015 Human genetics of diabetic nephropathy.
25532859 2015 When should clinicians search for GLUT1 deficiency syndrome in childhood generalized epilepsies?
25502934 2015 Glucose-dependent glucose transporter 1 expression and its impact on viability of thyroid cancer cells.
25492937 2015 Foxp3-mediated inhibition of Akt inhibits Glut1 (glucose transporter 1) expression in human T regulatory cells.
25433755 2014 Glucose transporter isoform-1 receptor-positive infantile capillary hemangiomas: case report and literature review.
25412955 2015 Gene and protein expression of glucose transporter 1 and glucose transporter 3 in human laryngeal cancer-the relationship with regulatory hypoxia-inducible factor-1? expression, tumor invasiveness, and patient prognosis.
25376377 2014 Practical utility of insulin-like growth factor II mRNA-binding protein 3, glucose transporter 1, and epithelial membrane antigen for distinguishing malignant mesotheliomas from benign mesothelial proliferations.
25367121 2014 Glucose transporter 1-expressing proinflammatory monocytes are elevated in combination antiretroviral therapy-treated and untreated HIV+ subjects.
25347093 2015 Role of SUVmax and GLUT-1 Expression in Determining Tumor Aggressiveness in Patients With Clinical Stage I Endometrioid Endometrial Cancer.
25339765 2015 Separate cellular localizations of human T-lymphotropic virus 1 (HTLV-1) Env and glucose transporter type 1 (GLUT1) are required for HTLV-1 Env-mediated fusion and infection.
25321477 2014 Glucose transporter 1-mediated glucose uptake is limiting for B-cell acute lymphoblastic leukemia anabolic metabolism and resistance to apoptosis.
25307508 2015 Cancer-specific interruption of glucose metabolism by resveratrol is mediated through inhibition of Akt/GLUT1 axis in ovarian cancer cells.
25306890 2015 Leptin at gender-specific concentrations does not affect glucose transport, expression of glucose transporters and leptin receptors in human lymphocytes.
25227787 2014 Overcoming 5-Fu resistance of colon cells through inhibition of Glut1 by the specific inhibitor WZB117.
25193692 2015 Does expression of glucose transporter protein-1 relate to prognosis and angiogenesis in osteosarcoma?
25187207 2015 Glucose transporter 1-positive endothelial cells in infantile hemangioma exhibit features of facultative stem cells.
25157747 2014 Regulation of human trophoblast GLUT1 glucose transporter by insulin-like growth factor I (IGF-I).
25132463 2015 Increased glucose and placental GLUT-1 in large infants of obese nondiabetic mothers.
25125078 2014 PTEN regulates plasma membrane expression of glucose transporter 1 and glucose uptake in thyroid cancer cells.
25121413 2014 Maximum standardized uptake value on 18F-fluoro-2-deoxy-glucose positron emission tomography/computed tomography and glucose transporter-1 expression correlates with survival in invasive ductal carcinoma of the pancreas.
25120770 2014 Apigenin suppresses GLUT-1 and p-AKT expression to enhance the chemosensitivity to cisplatin of laryngeal carcinoma Hep-2 cells: an in vitro study.
25056472 2014 Expression of glucose transporter protein 1 and p63 in serous ovarian tumor.
25022942 2014 Focal epilepsy in glucose transporter type 1 (Glut1) defects: case reports and a review of literature.
24980293 2014 Clinical features and hypoxic marker expression of primary sinonasal and laryngeal small-cell neuroendocrine carcinoma: a small case series.
24934577 2014 Significance of 18?F-FDG PET and immunohistochemical GLUT-1 expression for cardiac myxoma.
24932809 2014 Regulation of GLUT transporters by flavonoids in androgen-sensitive and -insensitive prostate cancer cells.
24847886 2014 Crystal structure of the human glucose transporter GLUT1.
24824604 2015 A novel SLC2A1 mutation linking hemiplegic migraine with alternating hemiplegia of childhood.
24824030 2014 Different expression of glucose transporters in the progression of intrahepatic cholangiocarcinoma.
24817962 2014 Co-expression of CD147 and GLUT-1 indicates radiation resistance and poor prognosis in cervical squamous cell carcinoma.
24745019 2014 The role of Hypoxia-inducible factor-1 ? , glucose transporter-1, (GLUT-1) and carbon anhydrase IX in endometrial cancer patients.
24726496 2014 Ezrin is down-regulated in diabetic kidney glomeruli and regulates actin reorganization and glucose uptake via GLUT1 in cultured podocytes.
24699711 2014 A DERL3-associated defect in the degradation of SLC2A1 mediates the Warburg effect.
24552568 2014 Adolescents with clinical type 1 diabetes display reduced red blood cell glucose transporter isoform 1 (GLUT1).
24502553 2015 Silencing of Glucose Transporter Protein-1 by RNA Interference Inhibits Human Osteosarcoma Mg63 Cells Growth in vivo.
24483274 2014 Glucose metabolism transporters and epilepsy: only GLUT1 has an established role.
24467213 2014 Identification of chemoresistance-related cell-surface glycoproteins in leukemia cells and functional validation of candidate glycoproteins.
24368212 2014 Metabolic activity on [18f]-fluorodeoxyglucose-positron emission tomography/computed tomography and glucose transporter-1 expression might predict clinical outcomes in patients with limited disease small-cell lung cancer who receive concurrent chemoradiation.
24343741 2014 Comparative immunohistochemical analysis of IMP3, GLUT1, EMA, CD146, and desmin for distinguishing malignant mesothelioma from reactive mesothelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24242681 2014 High expression of glucose transporter 1 on primary lesions of esophageal squamous cell carcinoma is associated with hematogenous recurrence.
24164300 2013 Overexpression of glucose transporter-1 (GLUT-1) predicts poor prognosis in epithelial ovarian cancer.
24146103 2013 Glucose transporter-1 expression in CD133+ laryngeal carcinoma Hep-2 cells.
23935399 2013 Clinicopathological implications of the expression of hypoxia-related proteins in gastric cancer.
23889809 2013 Tumor-suppressive microRNA-1291 directly regulates glucose transporter 1 in renal cell carcinoma.
23861325 2013 Glucose transporter 1 protein detected by enzyme-linked immunosorbent assay and immunocytochemistry: a useful diagnostic tool for malignant pleural effusions.
23744486 2013 Analysis of expression of membrane-bound tumor markers in ductal carcinoma in situ of the breast: paving the way for molecular imaging.
23740044 2013 Implications of aberrant temperature-sensitive glucose transport via the glucose transporter deficiency mutant (GLUT1DS) T295M for the alternate-access and fixed-site transport models.
23720776 2013 Sequence determinants of GLUT1 oligomerization: analysis by homology-scanning mutagenesis.
23674658 2013 18F-fluorodeoxyglucose positron emission tomography/computed tomography and the relationship between fluorodeoxyglucose uptake and the expression of hypoxia-inducible factor-1?, glucose transporter-1 and vascular endothelial growth factor in thymic epithelial tumours.
23661345 2013 Value of Glut-1 and Koc markers in the differential diagnosis of reactive mesothelial hyperplasia, malignant mesothelioma and pulmonary adenocarcinoma.
23617290 2013 Inhibition of glucose transporter 1 (GLUT1) chemosensitized head and neck cancer cells to cisplatin.
23615963 2013 Resolution of the direct interaction with and inhibition of the human GLUT1 hexose transporter by resveratrol from its effect on glucose accumulation.
23563491 2013 A global analysis of SNX27-retromer assembly and cargo specificity reveals a function in glucose and metal ion transport.
23483445 2013 Absence of SLC2A1 mutations does not exclude Glut1 deficiency syndrome.
23480298 2013 Association between glucose transporter 1 rs841853 polymorphism and type 2 diabetes mellitus risk may be population specific (1rs8418532).
23453806 2013 AMPK-dependent degradation of TXNIP upon energy stress leads to enhanced glucose uptake via GLUT1.
23427181 2013 Family-based association study between SLC2A1, HK1, and LEPR polymorphisms with myelomeningocele in Chile.
23359198 2012 Expression of Ki-67 (MIB-1) and GLUT-1 proteins in non-advanced prostatic cancer.
23306390 2013 The role of SLC2A1 in early onset and childhood absence epilepsies.
23280796 2012 Glucose transporter 1 deficiency in the idiopathic generalized epilepsies.
23227892 2013 Silencing of GLUT-1 inhibits sensitization of oral cancer cells to cisplatin during hypoxia.
23219802 2013 Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains.
23187830 2013 Expression and role of GLUT-1, MCT-1, and MCT-4 in malignant pleural mesothelioma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23108021 2013 IMP3 and GLUT-1 immunohistochemistry for distinguishing benign from malignant mesothelial proliferations.
23106342 2012 Early onset absence epilepsy: 1 in 10 cases is caused by GLUT1 deficiency.
23098453 2012 Expression of endogenous hypoxia markers in vulvar squamous cell carcinoma.
23076555 2013 Impact of GLUT1 and Ki-67 expression on early?stage lung adenocarcinoma diagnosed according to a new international multidisciplinary classification.
23030583 2013 Immunohistological expression of HIF-1?, GLUT-1, Bcl-2 and Ki-67 in consecutive biopsies during chemoradiotherapy in patients with rectal cancer.
23002041 2013 Distinguishing benign from malignant mesothelial cells in effusions by Glut-1, EMA, and Desmin expression: an evidence-based approach.
22971162 2012 Insulin receptor and glucose transporters mRNA expression throughout the menstrual cycle in human endometrium: a physiological and cyclical condition of tissue insulin resistance.
22961556 2013 Solute carrier family 2 member 1 is involved in the development of nonalcoholic fatty liver disease.
22901702 2012 Biologic correlation between glucose transporters, hexokinase-II, Ki-67 and FDG uptake in malignant melanoma.
22899793 2013 Lack of SLC2A1 (glucose transporter 1) mutations in 30 Italian patients with alternating hemiplegia of childhood.
22888973 2013 Comparison of 18F-fluorodeoxyglucose uptake with the expressions of glucose transporter type 1 and Na+/I- symporter in patients with untreated papillary thyroid carcinoma.
22847606 2013 Glucose transporter 1 (GLUT1) of anaerobic glycolysis as predictive and prognostic values in neoadjuvant chemoradiotherapy and laparoscopic surgery for locally advanced rectal cancer.
22843905 2012 Main effects and interactions of carbonic anhydrase IX, hypoxia-inducible factor-1?, ezrin and glucose transporter-1 in multivariate analysis for disease outcome in rectal cancer.
22835601 2012 Effect on the expression of MMP-2, MT-MMP in laryngeal carcinoma Hep-2 cell line by antisense glucose transporter-1.
22829208 2013 Vital staining with iodine solution in oral cancer: iodine infiltration, cell proliferation, and glucose transporter 1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22814174 2012 First report of glucose transporter 1 deficiency syndrome in Korea with a novel splice site mutation.
22813791 2012 Glycolysis inhibitors as a potential therapeutic option to treat aggressive neuroblastoma expressing GLUT1.
22812641 2012 Glucose transporter type I deficiency syndrome: epilepsy phenotypes and outcomes.
22800355 2012 [Expression of hypoxia inducible factor-1? and correlated target genes in human laryngeal carcinoma].
22795339 Investigation of SLC2A1 26177A/G gene polymorphism via high resolution melting curve analysis in Malaysian patients with diabetic retinopathy.
22707195 2012 Relationship between five GLUT1 gene single nucleotide polymorphisms and diabetic nephropathy: a systematic review and meta-analysis.
22704013 2012 Allelic variations of glut-1 deficiency syndrome: the chinese experience.
22673619 2012 Noncompetitive blocking of human GLUT1 hexose transporter by methylxanthines reveals an exofacial regulatory binding site.
22663547 2012 Triiodothyronine acutely stimulates glucose transport into L6 muscle cells without increasing surface GLUT4, GLUT1, or GLUT3.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22509097 2012 Multicenter cohort association study of SLC2A1 single nucleotide polymorphisms and age-related macular degeneration.
22492876 2012 An infant with pseudohyperkalemia, hemolysis, and seizures: cation-leaky GLUT1-deficiency syndrome due to a SLC2A1 mutation.
22483234 Immunohistochemical expression of GLUT1 and its correlation with unfavorable histology and TP53 codon 72 polymorphism in Wilms tumors.
22475893 2012 The relationship between GLUT-1 and vascular endothelial growth factor expression and 18F-FDG uptake in esophageal squamous cell cancer patients.
22470192 2012 [The role of glucose transporter 1 (GLUT1) in the diagnosis and therapy of tumors].
22437877 2012 A new GLUT-1 mutation in a family with glucose transporter 1 deficiency syndrome.
22398711 2012 Correlation between FDG uptake by PET/CT and the expressions of glucose transporter type 1 and hexokinase II in cervical cancer.
22376167 2012 The BRAF V600E mutation in papillary thyroid carcinoma is associated with glucose transporter 1 overexpression.
22363641 2012 Ligand-induced movements of inner transmembrane helices of Glut1 revealed by chemical cross-linking of di-cysteine mutants.
22308487 2012 Glut1-mediated glucose transport regulates HIV infection.
22282645 2012 GLUT1 mutations are a rare cause of familial idiopathic generalized epilepsy.
22282454 2013 Striatal presynaptic dopamine in schizophrenia, part II: meta-analysis of [(18)F/(11)C]-DOPA PET studies.
22270867 2012 Expression of GLUT1 and GLUT3 glucose transporters in endometrial and breast cancers.
22263435 2011 Relationship between erythrocyte GLUT1 function and membrane glycation in type 2 diabetes.
22253523 2012 ¹?F-fluoro-2-deoxyglucose uptake on PET CT and glucose transporter 1 expression in colorectal adenocarcinoma.
22234467 2012 Differential regulation of glucose transporters mediated by CRH receptor type 1 and type 2 in human placental trophoblasts.
22228332 2012 Glucose transporter 1 expression, tumor proliferation, and iodine/glucose uptake in thyroid cancer with emphasis on poorly differentiated thyroid carcinoma.
22221271 2012 The expression of the class 1 glucose transporter isoforms in human embryonic stem cells, and the potential use of GLUT2 as a marker for pancreatic progenitor enrichment.
22200795 2012 Overexpression of GLUT1 correlates with Kras mutations in lung carcinomas.
22199327 2011 Carbonic anhydrase IX, hypoxia-inducible factor-1?, ezrin and glucose transporter-1 as predictors of disease outcome in rectal cancer: multivariate Cox survival models following data reduction by principal component analysis of the clinicopathological predictors.
22153830 2012 Differences in metabolism between adeno- and squamous cell non-small cell lung carcinomas: spatial distribution and prognostic value of GLUT1 and MCT4.
22072148 2012 Prognostic significance of glucose transporter-1 (GLUT1) gene expression in rectal cancer after preoperative chemoradiotherapy.
22069254 2011 Persistent glucose transporter expression on pancreatic beta cells from longstanding type 1 diabetic individuals.
22029179 2011 Birthweight and fetal glycosylated hemoglobin at birth in newborns carrying the GLUT1 XbaI gene polymorphism.
22011817 2011 SLC2A1 gene analysis of Japanese patients with glucose transporter 1 deficiency syndrome.
21987722 2011 IKK? and NF-?B transcription govern lymphoma cell survival through AKT-induced plasma membrane trafficking of GLUT1.
21986508 2011 A potential role for glucose transporters in the evolution of human brain size.
21962875 2012 Glut1 deficiency: when to suspect and how to diagnose?
21938742 2012 Cellular distribution of Glut-1 and Glut-5 in benign and malignant human prostate tissue.
21920790 2011 GLUT2 (SLC2A2) is not the principal glucose transporter in human pancreatic beta cells: implications for understanding genetic association signals at this locus.
21899256 2011 Hexose transporter GLUT1 harbors several distinct regulatory binding sites for flavones and tyrphostins.
21870331 2011 GLUT1 and CAIX expression profiles in breast cancer correlate with adverse prognostic factors and MCT1 overexpression.
21838819 2011 Glucose transporter type 1 deficiency syndrome with carbohydrate-responsive symptoms but without epilepsy.
21832227 2011 Paroxysmal choreoathetosis/spasticity (DYT9) is caused by a GLUT1 defect.
21808860 2011 GLUT1 expression in malignant tumors and its use as an immunodiagnostic marker.
21791420 2011 Stomatin-deficient cryohydrocytosis results from mutations in SLC2A1: a novel form of GLUT1 deficiency syndrome.
21786248 Overexpression of GLUT1 in colorectal cancer is independently associated with poor prognosis.
21707071 2011 Transcriptomic and quantitative proteomic analysis of transporters and drug metabolizing enzymes in freshly isolated human brain microvessels.
21697701 2011 Wilms tumor 1 expression in vascular neoplasms and vascular malformations.
21555602 2011 Glucose transporter 1 deficiency as a treatable cause of myoclonic astatic epilepsy.
21546213 2011 A clinical and genetic study of 33 new cases with early-onset absence epilepsy.
21528061 2011 Clinicopathologic significance of GLUT1 expression and its correlation with Apaf-1 in colorectal adenocarcinomas.
21521642 2011 A large liver tumor in a 3-month-old girl. Diagnosis: GLUT1-negative hepatic vascular malformation with capillary proliferation.
21475039 2011 Glut-1 expression and in situ CD1a/CD57 immunologic deficit in keratoacanthoma and squamous cell carcinoma of immunocompetent patients.
21445818 2010 Absence of mutation in the SLC2A1 gene in a cohort of patients with alternating hemiplegia of childhood (AHC).
21442770 2011 Diagnostic value of metabolic phenotypes in malignant pleural effusions: expression of GLUT1 and CAIX by immunocytochemistry.
21438910 2011 Coexpression of hypoxia-inducible factor-1? and glucose transporter-1 is associated with poor prognosis in oral squamous cell carcinoma patients.
21411785 2011 The diagnostic utility of p16 FISH and GLUT-1 immunohistochemical analysis in mesothelial proliferations.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21395180 2010 [Expression of glucose transporter 1 in human laryngeal squamous cell carcinoma and its clinical significance].
21384913 2011 Determinants of ligand binding affinity and cooperativity at the GLUT1 endofacial site.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21343253 2011 Quantitative analysis of glucose transporter mRNAs in endometrial stromal cells reveals critical role of GLUT1 in uterine receptivity.
21332301 2011 Analysis of a promoter polymorphism of the GLUT1 gene in patients with hepatocellular carcinoma.
21321933 2011 Insulin regulates GLUT1-mediated glucose transport in MG-63 human osteosarcoma cells.
21317389 2011 Cutting edge: distinct glycolytic and lipid oxidative metabolic programs are essential for effector and regulatory CD4+ T cell subsets.
21306648 2011 In vivo identification and specificity assessment of mRNA markers of hypoxia in human and mouse tumors.
21295279 2011 Functional screening of Alzheimer pathology genome-wide association signals in Drosophila.
21294792 2012 Expression and clinical significance of glucose transporter 1 mRNA in bronchial brushing liquid-based cytology specimens from patients with and without lung cancer.
21281236 2011 Hypoxia-associated protein expression in primary central nervous system diffuse large B-cell lymphoma: does it predict prognosis?
21273616 2011 Pronounced tumour regression after radiotherapy is associated with negative/weak glucose transporter-1 expression in rectal cancer.
21270293 2011 4F2hc stabilizes GLUT1 protein and increases glucose transport activity.
21269460 2011 Initial characterization of the human central proteome.
21206329 2011 GLUT-1 expression in pancreatic neoplasia: implications in pathogenesis, diagnosis, and prognosis.
21204808 2010 Mild adolescent/adult onset epilepsy and paroxysmal exercise-induced dyskinesia due to GLUT1 deficiency.
21194153 2010 Glut1/SLC2A1 is crucial for the development of the blood-brain barrier in vivo.
21135204 2011 A 10 bp deletion polymorphism and 2 new variations in the GLUT1 gene associated with meningomyelocele.
21109935 2011 GLUT-1 staining of squamous cell carcinomas of the uterine cervix identifies a novel element of invasion.
21075472 2011 Diverging prognostic impacts of hypoxic markers according to NSCLC histology.
21033220 GLUT1 and Bcl-xL in relation to erythropoietin in human colorectal adenocarcinomas.
21029693 2010 [Uptake of 2-NBDG by human breast cancer cells in vitro].
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20947823 2011 Increase in GLUT1 in smooth muscle alters vascular contractility and increases inflammation in response to vascular injury.
20937822 2010 Protein kinase WNK1 promotes cell surface expression of glucose transporter GLUT1 by regulating a Tre-2/USP6-BUB2-Cdc16 domain family member 4 (TBC1D4)-Rab8A complex.
20854211 2010 Glucose transporter protein 1-targeted RNA interference inhibits growth and invasion of the osteosarcoma cell line MG63 in vitro.
20846124 2010 Cyclooxygenase-2, p53 and glucose transporter-1 as predictors of malignancy in the development of gallbladder carcinomas.
20830593 2011 Excellent response to acetazolamide in a case of paroxysmal dyskinesias due to GLUT1-deficiency.
20803547 2010 Glypican 3 binds to GLUT1 and decreases glucose transport activity in hepatocellular carcinoma cells.
20730618 2010 Mitochondrial and nuclear gene mutations in the type 2 diabetes patients of Coimbatore population.
20703861 2010 Correlation between glucose transporter-1 expression and 18F-fluoro-2-deoxyglucose uptake on positron emission tomography in lung cancer.
20687207 2010 Glut1 deficiency: inheritance pattern determined by haploinsufficiency.
20679470 2010 The XbaI G>T polymorphism of the glucose transporter 1 gene modulates 18F-FDG uptake and tumor aggressiveness in breast cancer.
20630673 2011 T295M-associated Glut1 deficiency syndrome with normal erythrocyte 3-OMG uptake.
20621801 2010 Paroxysmal exercise-induced dyskinesia, writer's cramp, migraine with aura and absence epilepsy in twin brothers with a novel SLC2A1 missense mutation.
20607826 2011 Warburg phenotype in renal cell carcinoma: high expression of glucose-transporter 1 (GLUT-1) correlates with low CD8(+) T-cell infiltration in the tumor.
20574033 2010 Absence epilepsies with widely variable onset are a key feature of familial GLUT1 deficiency.
20569445 2010 Relationships between hypoxia markers and the leptin system, estrogen receptors in human primary and metastatic breast cancer: effects of preoperative chemotherapy.
20540786 2010 The association of 18F-deoxyglucose (FDG) uptake of PET with polymorphisms in the glucose transporter gene (SLC2A1) and hypoxia-related genes (HIF1A, VEGFA, APEX1) in non-small cell lung cancer. SLC2A1 polymorphisms and FDG-PET in NSCLC patients.
20527231 2010 Expression and significance of beta-catenin, Glut-1 and PTEN in proliferative endometrium, endometrial intraepithelial neoplasia and endometrioid adenocarcinoma.
20526721 2010 Hypoxia and metabolic phenotypes during breast carcinogenesis: expression of HIF-1alpha, GLUT1, and CAIX.
20512538 2011 Glucose transporter-1 (GLUT-1) immunoreactivity in benign, premalignant and malignant lesions of the gallbladder.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20428049 2010 GLUT1 and GLUT3 as potential prognostic markers for Oral Squamous Cell Carcinoma.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20395120 2010 Glucose transporter Glut-1 is detectable in peri-necrotic regions in many human tumor types but not normal tissues: Study using tissue microarrays.
20382060 2010 Uncovering microdeletions in patients with severe Glut-1 deficiency syndrome using SNP oligonucleotide microarray analysis.
20375117 2010 Transgenic overexpression of GLUT1 in mouse glomeruli produces renal disease resembling diabetic glomerulosclerosis.
20221955 2009 Autosomal recessive inheritance of GLUT1 deficiency syndrome.
20129935 2010 Glucose transporter-1 deficiency syndrome: the expanding clinical and genetic spectrum of a treatable disorder.
20113375 2010 Glucose transporter protein 1 expression in mucoepidermoid carcinoma of salivary gland: correlation with grade of malignancy.
20079187 2009 [Expression of beta-catenin, Glut-1, PTEN proteins in uterine endometrioid adenocarcinoma and its precursor lesions].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20063428 2010 The spectrum of movement disorders in Glut-1 deficiency.
20030103 2009 [Distribution, GLUT-1 expression and early surgical intervention for infantile hemangioma on the face].
19955252 2010 Diabetes and obesity during pregnancy alter insulin signalling and glucose transporter expression in maternal skeletal muscle and subcutaneous adipose tissue.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19901175 2009 Childhood chorea with cerebral hypotrophy: a treatable GLUT1 energy failure syndrome.
19883765 2010 Purification and characterization of mammalian glucose transporters expressed in Pichia pastoris.
19822956 2009 XbaI GLUT1 gene polymorphism and the risk of type 2 diabetes with nephropathy.
19819644 2010 Expression of the GLUT1 glucose transporter and p53 in carcinomas of the pancreatobiliary tract.
19798636 2009 Early-onset absence epilepsy caused by mutations in the glucose transporter GLUT1.
19709351 2010 Overexpression of GLUT-1 in the invasion front is associated with depth of oral squamous cell carcinoma and prognosis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19681047 2009 Kinetics of transport and phosphorylation of glucose in cancer cells.
19655166 2010 Glycolytic phenotype in breast cancer: activation of Akt, up-regulation of GLUT1, TKTL1 and down-regulation of M2PK.
19648882 2009 Immunohistochemical differential diagnosis between thymic carcinoma and type B3 thymoma: diagnostic utility of hypoxic marker, GLUT-1, in thymic epithelial neoplasms.
19648108 2009 Targeting glucose consumption and autophagy in myeloma with the novel nucleoside analogue 8-aminoadenosine.
19630075 2009 GLUT1 gene mutations cause sporadic paroxysmal exercise-induced dyskinesias.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19619276 2009 GLUT1 gene is a potential hypoxic marker in colorectal cancer patients.
19587357 2009 A systematic meta-analysis of genetic association studies for diabetic retinopathy.
19569052 2009 GLUT-1 expression and response to chemoradiotherapy in rectal cancer.
19554504 2009 Expression of hexokinases and glucose transporters in treated and untreated oesophageal adenocarcinoma.
19536037 2009 Glut1 and Glut3 expression in lymphoma and their association with tumor intensity on 18F-fluorodeoxyglucose positron emission tomography.
19533890 2008 Diversity in genes responsible for lifestyle-related diseases in Asia-Pacific region.
19533082 2009 Rosiglitazone enhances glucose uptake in glomerular podocytes using the glucose transporter GLUT1.
19490621 2009 Impaired glucose transporter-1 degradation and increased glucose transport and oxidative stress in response to high glucose in chondrocytes from osteoarthritic versus normal human cartilage.
19465749 2009 Glucose transporter GLUT1 expression is an stage-independent predictor of clinical outcome in adrenocortical carcinoma.
19449892 2009 Model of the exofacial substrate-binding site and helical folding of the human Glut1 glucose transporter based on scanning mutagenesis.
19434538 2009 [Expression of glucose transporter 1 in gastric carcinoma and metastatic lymph nodes and its association with prognosis].
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19386788 2009 Endofacial competitive inhibition of the glucose transporter 1 activity by gossypol.
19366592 2009 Identification of a key residue determining substrate affinity in the human glucose transporter GLUT1.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19347605 2010 Frequency distribution of XbaIG > T and HaeIIIT > C GLUT1 polymorphisms among different Brazilian ethnic groups.
19304421 2009 The expanding phenotype of GLUT1-deficiency syndrome.
19303158 2009 HCV replication suppresses cellular glucose uptake through down-regulation of cell surface expression of glucose transporters.
19292042 2009 [Expression of glucose transporter 1 in human breast carcinoma and its clinical significance].
19289587 2009 Usefulness of EMA, GLUT-1, and XIAP for the cytologic diagnosis of malignant mesothelioma in body cavity fluids.
19286567 2009 GLUT1 expression is increased in hepatocellular carcinoma and promotes tumorigenesis.
19234439 2009 Glucose transporter-1 in pulmonary neuroendocrine carcinomas: expression and survival analysis.
19173807 2008 [Correlation between SUV of (18)F-FDG PET-CT and the expression of GLUT1, MVD and Ki67 in non-small cell lung cancer].
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19166280 2009 The role of GLUT1 in the sugar-induced dielectric response of human erythrocytes.
19152396 2009 Polymorphisms at GLUT1 gene are not associated with the development of TSP/HAM in Brazilian HTLV-1 infected individuals and the discovery of a new polymorphism at GLUT1 gene.
19142800 2009 Relations of TGF-beta1 with HIF-1 alpha, GLUT-1 and longer survival of colorectal cancer patients.
19085834 2009 Glucose transporter-1 expression and prognostic significance in pancreatic carcinogenesis.
19020742 2008 Analysis of hypoxia-associated gene expression in prostate cancer: lysyl oxidase and glucose transporter-1 expression correlate with Gleason score.
19020718 2008 Expression of Glut-1 is a prognostic marker for oral squamous cell carcinoma patients.
19016655 2009 An essential role for the Glut1 PDZ-binding motif in growth factor regulation of Glut1 degradation and trafficking.
18990414 2008 Glut1 deficiency: CSF glucose. How low is too low?
18987250 2009 alpha- and beta-monosaccharide transport in human erythrocytes.
18981181 2008 Analysis of glucose transporter topology and structural dynamics.
18973239 2009 Effects of hypoxia on glucose transport in primary equine chondrocytes in vitro and evidence of reduced GLUT1 gene expression in pathologic cartilage in vivo.
18953257 2008 Apigenin inhibits the GLUT-1 glucose transporter and the phosphoinositide 3-kinase/Akt pathway in human pancreatic cancer cells.
18948400 2009 Facilitative glucose transporter type 1 is differentially regulated by progesterone and estrogen in murine and human endometrial stromal cells.
18821326 Risk genotypes and haplotypes of the GLUT1 gene for type 2 diabetic nephropathy in the Tunisian population.
18764953 2008 Immunohistochemical expression of the glucose transporters Glut-1 and Glut-3 in human malignant melanomas and benign melanocytic lesions.
18726700 2008 Expression of glucose transporter 1 is associated with loss of heterozygosity of chromosome 1p in oligodendroglial tumors WHO grade II.
18695903 2008 No relationship between 18F-fluorodeoxyglucose positron emission tomography and expression of Glut-1 and -3 and hexokinase I and II in high-grade glioma.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18614966 2008 Functional studies of the T295M mutation causing Glut1 deficiency: glucose efflux preferentially affected by T295M.
18613291 2008 Association of glucose transporter 1 polymorphisms with type 2 diabetes in the Tunisian population.
18577546 2008 Paroxysmal exercise-induced dyskinesia and epilepsy is due to mutations in SLC2A1, encoding the glucose transporter GLUT1.
18565734 2008 Expression of GLUT-1 in psoriasis and the relationship between GLUT-1 upregulation induced by hypoxia and proliferation of keratinocyte growth.
18451999 2008 GLUT1 mutations are a cause of paroxysmal exertion-induced dyskinesias and induce hemolytic anemia by a cation leak.
18422279 2008 [Expression of glucose transporter in non-small cell lung carcinoma and its clinical significance].
18410529 2009 Resistin modulates glucose uptake and glucose transporter-1 (GLUT-1) expression in trophoblast cells.
18401196 2008 Expression of glucose transporter-1 and -3 in the head and neck carcinoma--the correlation of the expression with the biological behaviors.
18387950 2008 Structural signatures and membrane helix 4 in GLUT1: inferences from human blood-brain glucose transport mutants.
18351386 2008 Presence of HIF-1 and related genes in normal mucosa, adenomas and carcinomas of the colorectum.
18347014 2008 Dematin and adducin provide a novel link between the spectrin cytoskeleton and human erythrocyte membrane by directly interacting with glucose transporter-1.
18343752 2008 Differential expression of Glut 1 mRNA and protein levels correlates with increased sensitivity to the glyco-conjugated nitric oxide donor (2-glu-SNAP) in different tumor cell types.
18324916 2008 Significance of GLUT1 expression in adenocarcinoma and adenoma of the ampulla of Vater.
18311082 2008 The GLUT-1 XbaI gene polymorphism is associated with vascular calcifications in nondiabetic uremic patients.
18290322 2008 Endogenous hypoxia markers: case not proven!
18271924 2008 Expression of glucose transporters and hexokinase II in cholangiocellular carcinoma compared using [18F]-2-fluro-2-deoxy-D-glucose positron emission tomography.
18246802 2007 [Expression of GLUT-1, p63 and DNA-Pkcs in serous ovarian tumors and their significance].
18245775 2008 Transmembrane segment 6 of the Glut1 glucose transporter is an outer helix and contains amino acid side chains essential for transport activity.
18227718 2008 Expression of Glut-1 and Claudin-1 in follicular dendritic cell sarcoma.
18212354 2008 Genes in glucose metabolism and association with spina bifida.
18191496 2008 Correlation between FDG uptake and glucose transporter type 1 expression in neuroendocrine tumors of the lung.
18177733 2008 GLUT1 and GLUT9 as major contributors to glucose influx in HepG2 cells identified by a high sensitivity intramolecular FRET glucose sensor.
18172662 2008 Expression of glucose transporters GLUT-1, GLUT-3, GLUT-9 and HIF-1alpha in normal and degenerate human intervertebral disc.
18097583 2008 Expression of hypoxia inducible factor-1alpha (HIF-1alpha) and glucose transporter-1 (GLUT-1) in ovarian adenocarcinomas: difference in hypoxic status depending on histological character.
17991316 2007 [Expression and significance of GLUT-1 and DNA-PKcs in serous ovarian tumors].
17854396 2008 Molecular characteristics in papillary thyroid cancers (PTCs) with no 131I uptake.
17727838 2007 Gatifloxacin affects GLUT1 gene expression and disturbs glucose homeostasis in vitro.
17635959 2007 Structural basis of GLUT1 inhibition by cytoplasmic ATP.
17611657 2007 Expression of glucose transporters in epithelial ovarian carcinoma: correlation with clinical characteristics and tumor angiogenesis.
17591274 2007 [Relationship between adaptation to high altitude hypoxia environment and glucose transport 1 gene polymorphism].
17554865 2007 [The expression and role of glucose transporter-1 in infantile hemangioma].
17504522 2007 Isolated receptor binding domains of HTLV-1 and HTLV-2 envelopes bind Glut-1 on activated CD4+ and CD8+ T cells.
17452775 2007 Stromal expression of hypoxia regulated proteins is an adverse prognostic factor in colorectal carcinomas.
17451637 2007 Down-regulation of N-acetylglucosaminyltransferase-V induces ER stress by changing glycosylation and function of GLUT1.
17442736 2007 Hypoxic upregulation of glucose transporters in BeWo choriocarcinoma cells is mediated by hypoxia-inducible factor-1.
17404017 2007 Significant coexpression of GLUT-1, Bcl-xL, and Bax in colorectal cancer.
17387384 2007 Clinicopathological significance and linkage of the distribution of HIF-1alpha and GLUT-1 in human primary colorectal cancer.
17294670 2006 Evaluation of 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography in gastric carcinoma: relation to histological subtypes, depth of tumor invasion, and glucose transporter-1 expression.
17192790 2007 Immunohistochemical detection of GLUT-1 can discriminate between reactive mesothelium and malignant mesothelioma.
17167225 2006 Increased glucose uptake and metabolism in mesangial cells overexpressing glucose transporter 1 increases interleukin-6 and vascular endothelial growth factor production: role of AP-1 and HIF-1alpha.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17080242 2006 Correlation of GLUT-1 overexpression, tumor size, and depth of invasion with 18F-2-fluoro-2-deoxy-D-glucose uptake by positron emission tomography in colorectal cancer.
17071132 2007 Glucose transporter type 1 expression are associated with poor prognosis in patients with salivary gland tumors.
17064664 2006 Mammalian glucose permease GLUT1 facilitates transport of arsenic trioxide and methylarsonous acid.
17020877 2006 Transmembrane segment 12 of the Glut1 glucose transporter is an outer helix and is not directly involved in the transport mechanism.
16842248 2006 GLUT1 and p63 expression in endometrial intraepithelial and uterine serous papillary carcinoma.
16800634 2006 Ultrastructure of human erythrocyte GLUT1.
16681688 2006 Immunodetection of GLUT1, p63 and phospho-histone H1 in invasive head and neck squamous carcinoma: correlation of immunohistochemical staining patterns with keratinization.
16681687 2006 Immunohistochemical detection of GLUT1, p63 and phosphorylated histone H1 in head and neck squamous intraepithelial neoplasia: evidence for aberrations in hypoxia-related, cell cycle- and stem-cell-regulatory pathways.
16519917 2006 Infection of CD4+ T lymphocytes by the human T cell leukemia virus type 1 is mediated by the glucose transporter GLUT-1: evidence using antibodies specific to the receptor's large extracellular domain.
16443776 2006 SGK1 kinase upregulates GLUT1 activity and plasma membrane expression.
16407180 2006 Docking studies show that D-glucose and quercetin slide through the transporter GLUT1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16310037 2006 Effects of chronic hypoxia in vivo on the expression of human placental glucose transporters.
16273245 2005 Glucose transporter-1 expression in the thyroid gland: clinicopathological significance for papillary carcinoma.
16220828 2005 Prognostic value of GLUT-1 expression in ovarian surface epithelial tumors: a morphometric study.
16195374 2005 Vitamin C enters mitochondria via facilitative glucose transporter 1 (Glut1) and confers mitochondrial protection against oxidative injury.
16172126 2005 Cysteine-scanning mutagenesis and substituted cysteine accessibility analysis of transmembrane segment 4 of the Glut1 glucose transporter.
16147855 2005 GLUT1 is highly expressed in cementoblasts but not in osteoblasts.
16142350 2005 Expression of HIF-1alpha and Glut-1 in human bladder cancer.
16136514 2005 Hypoxia inducible factor-1 and facilitative glucose transporters GLUT1 and GLUT3: putative molecular components of the oxygen and glucose sensing apparatus in articular chondrocytes.
16126902 2005 Glucose transporter 1 expression identifies a population of cycling CD4+ CD8+ human thymocytes with high CXCR4-induced chemotaxis.
16125330 2005 Impaired neuronal glucose uptake in pathogenesis of schizophrenia - can GLUT 1 and GLUT 3 deficits explain imaging, post-mortem and pharmacological findings?
15967114 2005 [18F]FDG uptake and PCNA, Glut-1, and Hexokinase-II expressions in cancers and inflammatory lesions of the lung.
15955807 2005 Human T cell leukemia virus envelope binding and virus entry are mediated by distinct domains of the glucose transporter GLUT1.
15924676 2005 [Expression of glucose transporter-1 and its correlation with basic fibroblast growth factor and proliferating cell nuclear antigen in epithelial ovarian neoplasm].
15847702 2005 The prognostic value of the hypoxia markers CA IX and GLUT 1 and the cytokines VEGF and IL 6 in head and neck squamous cell carcinoma treated by radiotherapy +/- chemotherapy.
15823019 2005 Properties of the human erythrocyte glucose transport protein are determined by cellular context.
15778389 2005 Induction of human T cell leukemia virus type I receptors on quiescent naive T lymphocytes by TGF-beta.
15767416 2005 Expression of glucose transporter 1 confers susceptibility to human T-cell leukemia virus envelope-mediated fusion.
15745834 A novel polymorphism in the 5' flanking region of the glucose transporter (GLUT1) gene is strongly associated with diabetic nephropathy in patients with Type 1 diabetes mellitus.
15709778 2005 Quench-flow analysis reveals multiple phases of GluT1-mediated sugar transport.
15682272 2005 Association between the GLUT1 gene polymorphism and the risk of diabetic nephropathy: a meta-analysis.
15622525 2005 Glut-1 deficiency syndrome: clinical, genetic, and therapeutic aspects.
15502921 2004 Cellular basis of diabetic nephropathy: III. In vitro GLUT1 mRNA expression and risk of diabetic nephropathy in type 1 diabetic patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454279 2004 Contribution of reactive oxygen species to the regulation of Glut1 in two hemopoietic cell lines differing in cytokine sensitivity.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15331928 2004 GLUT1 mRNA and protein expression in ovarian borderline tumors and cancer.
15166316 2004 Dissection of the mammalian midbody proteome reveals conserved cytokinesis mechanisms.
15147968 2004 Post-transcriptional regulation of glucose transporter-1 by an AU-rich element in the 3'UTR and by hnRNP A2.
15086844 2004 Intraneural perineurioma involving the ulnar nerve.
15073187 2004 Relative proximity and orientation of helices 4 and 8 of the GLUT1 glucose transporter.
14991538 2004 GLUT1 endothelial reactivity distinguishes hepatic infantile hemangioma from congenital hepatic vascular malformation with associated capillary proliferation.
14757434 Facilitative glucose transporter gene expression in human lymphocytes, monocytes, and macrophages: a role for GLUT isoforms 1, 3, and 5 in the immune response and foam cell formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688257 2004 Analysis of transmembrane segment 8 of the GLUT1 glucose transporter by cysteine-scanning mutagenesis and substituted cysteine accessibility.
14674124 2003 Expression of GLUT1 gene in breast cancer cell lines MCF-7 and MDA-MB-231.
14622599 2003 The ubiquitous glucose transporter GLUT-1 is a receptor for HTLV.
14605501 2003 GLUT-1 deficiency without epilepsy--an exceptional case.
12969152 2003 Regulation of cytosolic pH and lactic acid release in mesangial cells overexpressing GLUT1.
12942120 2003 Glucose transporter-1 (GLUT-1): a potential marker of prognosis in rectal carcinoma?
12849991 2003 RNA interference-mediated reduction in GLUT1 inhibits serum-induced glucose transport in primary human skeletal muscle cells.
12752470 2003 Seizure characterization and electroencephalographic features in Glut-1 deficiency syndrome.
12673735 2003 Expression and localization of GLUT1 and GLUT12 in prostate carcinoma.
12583599 2002 Placental glucose transfer and fetal growth.
12554125 2003 Molecular characterization and partial cDNA cloning of facilitative glucose transporters expressed in human articular chondrocytes; stimulation of 2-deoxyglucose uptake by IGF-I and elevated MMP-2 secretion by glucose deprivation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393496 2003 The HTLV receptor is an early T-cell activation marker whose expression requires de novo protein synthesis.
12379106 2002 Cooperative nucleotide binding to the human erythrocyte sugar transporter.
12379105 2002 Molecular determinants of sugar transport regulation by ATP.
12325075 2002 Imaging the metabolic footprint of Glut1 deficiency on the brain.
12145475 2002 Downregulation of metabolic gene expression in failing human heart before and after mechanical unloading.
12133004 2002 Interactions of ATP, oestradiol, genistein and the anti-oestrogens, faslodex (ICI 182780) and tamoxifen, with the human erythrocyte glucose transporter, GLUT1.
12122099 2002 Coexpression of glucose transporter 1 and matrix metalloproteinase-2 in human cancers.
12112827 2002 Immunolocalization of glucose transporter 1 and 3 in the placenta: application to cytodiagnosis of Papanicolaou smear.
12064911 Sustained hypoglycemia affects glucose transporter expression of human blood leukocytes.
11991658 2002 Human articular chondrocytes express three facilitative glucose transporter isoforms: GLUT1, GLUT3 and GLUT9.
11953883 2002 Molecular changes in the expression of human colonic nutrient transporters during the transition from normality to malignancy.
11842083 2002 The insulin-sensitive glucose transporter, GLUT4, interacts physically with Daxx. Two proteins with capacity to bind Ubc9 and conjugated to SUMO1.
11836704 2002 Diagnostic utility of Glut-1 and CA 15-3 in discriminating adenocarcinoma from hepatocellular carcinoma in liver tumors biopsied by fine-needle aspiration.
11774318 2002 Probe of specific interaction between a simplified synthetic glycopolymer and erythrocytes as mediated by a glucose transporter (GLUT) on a cell membrane.
11681785 Structural analysis of the GLUT1 facilitative glucose transporter (review).
11603379 2001 Autosomal dominant glut-1 deficiency syndrome and familial epilepsy.
11483777 2001 Human T-cell leukemia virus type 1 receptor expression among syncytium-resistant cell lines revealed by a novel surface glycoprotein-immunoadhesin.
11477169 2001 Diabetic microvascular complications are not associated with two polymorphisms in the GLUT-1 and PC-1 genes regulating glucose metabolism in Caucasian type 1 diabetic patients.
11425315 2001 The predicted ATP-binding domains in the hexose transporter GLUT1 critically affect transporter activity.
11296192 2001 Protecting the myocardium from ischemic injury: a critical role for alpha(1)-adrenoreceptors?
11231353 2001 Polymorphisms of the glucose transporter (GLUT1) gene are associated with diabetic nephropathy.
11168944 2001 Role of GLUT1 gene in susceptibility to diabetic nephropathy in type 2 diabetes.
11136715 2001 Autosomal dominant transmission of GLUT1 deficiency.
11007796 2000 Glucose activates mitogen-activated protein kinase (extracellular signal-regulated kinase) through proline-rich tyrosine kinase-2 and the Glut1 glucose transporter.
10980529 2000 Mutational analysis of GLUT1 (SLC2A1) in Glut-1 deficiency syndrome.
10862609 2000 Dehydroascorbic acid transport by GLUT4 in Xenopus oocytes and isolated rat adipocytes.
10759149 2000 Golgi targeting of the GLUT1 glucose transporter in lactating mouse mammary gland.
10655495 2000 The sentrin-conjugating enzyme mUbc9 interacts with GLUT4 and GLUT1 glucose transporters and regulates transporter levels in skeletal muscle cells.
10562431 1999 Association of stomatin (band 7.2b) with Glut1 glucose transporter.
10227690 1999 Defective glucose transport across brain tissue barriers: a newly recognized neurological syndrome.
10198040 1999 Protein interactions with the glucose transporter binding protein GLUT1CBP that provide a link between GLUT1 and the cytoskeleton.
10086067 1997 Glucose transporter (Glut1, Glut3) mRNA in human placenta of diabetic and non-diabetic pregnancies.
9751501 1998 Different functional domains of GLUT2 glucose transporter are required for glucose affinity and substrate specificity.
9462754 1998 GLUT-1 deficiency syndrome caused by haploinsufficiency of the blood-brain barrier hexose carrier.
9330634 1997 Assignment of the possible HTLV receptor gene to chromosome 17q21-q23.
9228080 1997 Glucose transporter isoforms GLUT1 and GLUT3 transport dehydroascorbic acid.
9153243 1997 The thiol-dependent reductase ERp57 interacts specifically with N-glycosylated integral membrane proteins.
9110174 1997 Large-scale concatenation cDNA sequencing.
8839927 1996 Structure, function, and regulation of the mammalian facilitative glucose transporter gene family.
8794391 1996 Broad host range of human T-cell leukemia virus type 1 demonstrated with an improved pseudotyping system.
8662691 1996 The glut 1 glucose transporter interacts with calnexin and calreticulin.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8457197 1993 Kinetic analysis of the liver-type (GLUT2) and brain-type (GLUT3) glucose transporters in Xenopus oocytes: substrate specificities and effects of transport inhibitors.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7798206 1994 Discrete structural domains determine differential endoplasmic reticulum to Golgi transit times for glucose transporter isoforms.
7593639 1995 Human and rat beta cells differ in glucose transporter but not in glucokinase gene expression.
7589840 1995 Pancreatic islet GLUT2 glucose transporter mRNA and protein expression in humans with and without NIDDM.
3839598 1985 Sequence and structure of a human glucose transporter.
3201246 1988 Human T cell leukemia viruses use a receptor determined by human chromosome 17.
3170580 1988 Evidence for a family of human glucose transporter-like proteins. Sequence and gene localization of a protein expressed in fetal skeletal muscle and other tissues.
3028891 1987 Polymorphic human glucose transporter gene (GLUT) is on chromosome 1p31.3----p35.
2834252 1988 Characterization and expression of human HepG2/erythrocyte glucose-transporter gene.
2656669 1989 Cloning and characterization of the major insulin-responsive glucose transporter expressed in human skeletal muscle and other insulin-responsive tissues.
2394733 1990 An ATP-modulated specific association of glyceraldehyde-3-phosphate dehydrogenase with human erythrocyte glucose transporter.
1429721 1992 Glucose transporter oligomeric structure determines transporter function. Reversible redox-dependent interconversions of tetrameric and dimeric GLUT1.