Property Summary

Ligand Count 9
NCBI Gene PubMed Count 17
PubMed Score 80.75
PubTator Score 51.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.4e-40
ductal carcinoma in situ 1745 3.1e-03
osteosarcoma 7950 1.0e-02
group 3 medulloblastoma 4104 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
ductal carcinoma in situ -1.200 3.1e-03
group 3 medulloblastoma 1.200 1.9e-02
lung carcinoma 3.500 1.4e-40
osteosarcoma -1.272 1.0e-02

Gene RIF (13)

AA Sequence

MGSVGSQRLEEPSVAGTPDPGVVMSFTFDSHQLEEAAEAAQGQGLRARGVPAFTDTTLDEPVPDDRYHAI      1 - 70
YFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRITAGY     71 - 140
LLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAG    141 - 210
VMISLSRILTKLLLPDERASTLIFFLVSVALELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYG    211 - 280
YRVHHDVVAGDVHFEHPAPALAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVA    281 - 350
RVIWADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLAC    351 - 420
SCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVS    421 - 490
YMSGLTLGSAVAYCTYSLTRDAHGSCLHASTANGSILAGL                                  491 - 530
//

Text Mined References (19)

PMID Year Title