Property Summary

NCBI Gene PubMed Count 32
PubMed Score 115.50
PubTator Score 87.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.5e-12
malignant mesothelioma 3163 9.1e-09
group 3 medulloblastoma 2254 6.9e-05
osteosarcoma 7933 1.4e-03

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 4.700 9.1e-09
osteosarcoma -1.244 1.4e-03
group 3 medulloblastoma -1.700 6.9e-05
ovarian cancer 1.400 2.5e-12

Gene RIF (22)

PMID Text
23639800 Data suggest that SLC29A2 is localized to apical membrane of adult Sertoli cells. In contrast, SLC29A1 is located on basolateral membrane of Sertoli cells; SLC29A1 is primarily responsible for basolateral nucleoside uptake into Sertoli cells.
23590299 these findings reveal the transcriptional repression of ENT1,2 as an innate protective response during acute pulmonary inflammation.
21822668 Data show that ENT1, ENT2, ENT4 and CNT3 protein was detected on ovarian carcinoma cells in all effusions, with expression observed in 1-95% of tumor cells.
21156465 Studies show that ABCC4 and SLC29A2 expression were predictive of achieving CR, and the high expression of GSTP1 suggests that this may be a therapeutic target for relapsed AML.
20392501 Observational study of gene-disease association. (HuGE Navigator)
19297449 This evidence suggested that apical CNT3 and basolateral ENT2 are involved in proximal tubular reabsorption of adenosine and some nucleoside drugs and that apical ENT1 is involved in proximal tubular secretion of 2'-deoxyadenosine.
19105964 HIF-1alpha-dependent repression of ENT2 increases mucosal adenosine signaling and attenuates hypoxia-associated inflammation of the intestine.
18945750 correlation between the recently described p53-inducible apoptosis gene TIGAR and both sensitivity to fludarabine and hENT2 expression in chronic lymphocytic leukemia cells.
18703227 hPMEC from pre-eclampsia exhibit increased total transport (hENT1+hENT2), and maximal velocity (Vmax) for hENT2- (2-fold), but reduced Vmax for hENT1-mediated adenosine transport
18635603 Report expression and hepatobiliary transport characteristics of ENT2 in sandwich-cultured human hepatocytes.
17926640 These data suggest that selected genes of the SLC28 and SLC29 families are not only targets of HIV-1 infection, but might also contribute to the development of adipose tissue alterations leading to lipodystrophy.
17921321 Human cardiac microvascular endothelial cells rely on ENT1 for nucleoside transport with little contribution from ENT2.
16924660 Data show that insulin restores glucose inhibition of adenosine transport by increasing the expression and activity of the equilibrative nucleoside transporter 2 in human umbilical vein endothelium.
16214850 The low overall genetic diversity in SLC29A2 makes it unlikely that variation in the coding region contributes significantly to clinically observed differences in drug response.
15649894 the corresponding residues in TMs 1 and 11 of hENT1, hENT2, and CeENT1 are important for dipyridamole interactions and nucleoside transport.
15644498 residue 33 resides in an extracellular domain as predicted by the current hENT2 topology model and suggested that it is a functionally important component of both the permeant and dipyridamole binding sites.
15386342 Only a few endometrial carcinomas (15%) were found to be negative for hCNT1, but they all retained hENT1 and hENT2 expression.
12820662 Equilibrative nucleoside transporters (hENT1, hENT2) together with adenosine kinase and 5'-nucleotidase play a crucial role in the regulation of CFTR through an adenosine-dependent pathway in human airway epithelia.
12590919 an analysis of function by site-directed glycosylation mutagenesis
12527552 hENT1 and hENT2 on the basolateral membrane function with concentrative nucleoside transporters on the apical membrane to mediate active reabsorption of nucleosides within the kidney.
12006583 role in functional and molecular characterization of nucleobase transport
9478986 Functional nucleoside transporter in stable and transient transfection studies in mammalian cells.

AA Sequence

MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNW      1 - 70
VTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVDMSPGPFFSITMASVCFINSF     71 - 140
SAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLLSMASGVDAETSALGYFITPCVGILMSIVCY    141 - 210
LSLPHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGK    211 - 280
PSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSY    281 - 350
FLWPDEDSRLLPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR    351 - 420
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL                                      421 - 456
//

Text Mined References (37)

PMID Year Title
23639800 2013 Basolateral uptake of nucleosides by Sertoli cells is mediated primarily by equilibrative nucleoside transporter 1.
23590299 2013 Repression of the equilibrative nucleoside transporters dampens inflammatory lung injury.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21822668 2012 Nucleoside transporters are widely expressed in ovarian carcinoma effusions.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21156465 2010 A Phase II trial of gemcitabine and mitoxantrone for patients with acute myeloid leukemia in first relapse.
20392501 2010 Contribution of adenosine related genes to the risk of depression with disturbed sleep.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19297449 2009 Transepithelial fluxes of adenosine and 2'-deoxyadenosine across human renal proximal tubule cells: roles of nucleoside transporters hENT1, hENT2, and hCNT3.
19105964 2009 Hypoxia-inducible factor-dependent repression of equilibrative nucleoside transporter 2 attenuates mucosal inflammation during intestinal hypoxia.
18945750 2008 Identification of TIGAR in the equilibrative nucleoside transporter 2-mediated response to fludarabine in chronic lymphocytic leukemia cells.
18703227 2008 Human equilibrative nucleoside transporters 1 and 2 may be differentially modulated by A2B adenosine receptors in placenta microvascular endothelial cells from pre-eclampsia.
18635603 2008 Expression and hepatobiliary transport characteristics of the concentrative and equilibrative nucleoside transporters in sandwich-cultured human hepatocytes.
17926640 2007 Altered expression of nucleoside transporter genes (SLC28 and SLC29) in adipose tissue from HIV-1-infected patients.
17921321 2007 Nucleoside and nucleobase transporters of primary human cardiac microvascular endothelial cells: characterization of a novel nucleobase transporter.
16924660 2006 Insulin restores glucose inhibition of adenosine transport by increasing the expression and activity of the equilibrative nucleoside transporter 2 in human umbilical vein endothelium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16214850 2006 Functional characterization and haplotype analysis of polymorphisms in the human equilibrative nucleoside transporter, ENT2.
15649894 2005 Identification and mutational analysis of amino acid residues involved in dipyridamole interactions with human and Caenorhabditis elegans equilibrative nucleoside transporters.
15644498 2005 Residue 33 of human equilibrative nucleoside transporter 2 is a functionally important component of both the dipyridamole and nucleoside binding sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386342 2004 Expression of the nucleoside-derived drug transporters hCNT1, hENT1 and hENT2 in gynecologic tumors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612157 2003 Nucleoside transporters in the disposition and targeting of nucleoside analogs in the kidney.
12838422 2004 The equilibrative nucleoside transporter family, SLC29.
12820662 2003 Coupling of CFTR-mediated anion secretion to nucleoside transporters and adenosine homeostasis in Calu-3 cells.
12590919 2003 Functional analysis of site-directed glycosylation mutants of the human equilibrative nucleoside transporter-2.
12527552 2003 Localization of human equilibrative nucleoside transporters, hENT1 and hENT2, in renal epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411296 2003 Fludarabine uptake mechanisms in B-cell chronic lymphocytic leukemia.
12006583 2002 Functional and molecular characterization of nucleobase transport by recombinant human and rat equilibrative nucleoside transporters 1 and 2. Chimeric constructs reveal a role for the ENT2 helix 5-6 region in nucleobase translocation.
9478986 1998 Cloning of the human equilibrative, nitrobenzylmercaptopurine riboside (NBMPR)-insensitive nucleoside transporter ei by functional expression in a transport-deficient cell line.
9396714 1997 Molecular cloning and characterization of a nitrobenzylthioinosine-insensitive (ei) equilibrative nucleoside transporter from human placenta.
9192854 1997 The human HNP36 gene is localized to chromosome 11q13 and produces alternative transcripts that are not mutated in multiple endocrine neoplasia, type 1 (MEN I) syndrome.
7639753 1995 A mammalian delayed-early response gene encodes HNP36, a novel, conserved nucleolar protein.