Property Summary

Ligand Count 182
NCBI Gene PubMed Count 135
PubMed Score 427.15
PubTator Score 325.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
aldosterone-producing adenoma -1.621 4.8e-02
Astrocytoma, Pilocytic 1.200 2.1e-03
atypical teratoid / rhabdoid tumor 1.500 3.9e-04
cutaneous lupus erythematosus -1.100 4.2e-03
dermatomyositis -1.700 4.8e-04
ductal carcinoma in situ -1.300 8.6e-04
ependymoma 1.200 1.5e-03
glioblastoma 1.800 2.8e-04
lung cancer 1.100 1.2e-02
malignant mesothelioma 1.700 9.1e-07
medulloblastoma, large-cell 2.000 2.8e-04
osteosarcoma 1.573 4.6e-02
pediatric high grade glioma 1.400 2.1e-03
primitive neuroectodermal tumor 1.100 1.0e-03
psoriasis -1.400 1.4e-04
sonic hedgehog group medulloblastoma 1.400 1.2e-02

Protein-protein Interaction (2)

Gene RIF (125)

AA Sequence

MTTSHQPQDRYKAVWLIFFMLGLGTLLPWNFFMTATQYFTNRLDMSQNVSLVTAELSKDAQASAAPAAPL      1 - 70
PERNSLSAIFNNVMTLCAMLPLLLFTYLNSFLHQRIPQSVRILGSLVAILLVFLITAILVKVQLDALPFF     71 - 140
VITMIKIVLINSFGAILQGSLFGLAGLLPASYTAPIMSGQGLAGFFASVAMICAIASGSELSESAFGYFI    141 - 210
TACAVIILTIICYLGLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESH    211 - 280
SIKAILKNISVLAFSVCFIFTITIGMFPAVTVEVKSSIAGSSTWERYFIPVSCFLTFNIFDWLGRSLTAV    281 - 350
FMWPGKDSRWLPSLVLARLVFVPLLLLCNIKPRRYLTVVFEHDAWFIFFMAAFAFSNGYLASLCMCFGPK    351 - 420
KVKPAEAETAGAIMAFFLCLGLALGAVFSFLFRAIV                                      421 - 456
//

Text Mined References (142)

PMID Year Title