Property Summary

NCBI Gene PubMed Count 114
PubMed Score 397.32
PubTator Score 325.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.100 2.4e-07
cutaneous lupus erythematosus -1.100 4.2e-03
psoriasis -2.000 1.7e-05
osteosarcoma 1.573 4.6e-02
posterior fossa group A ependymoma 1.500 2.0e-04
atypical teratoid / rhabdoid tumor 1.500 3.9e-04
glioblastoma 1.800 2.8e-04
medulloblastoma, large-cell 2.000 2.8e-04
primitive neuroectodermal tumor 1.100 1.0e-03
lung cancer 1.100 1.2e-02
pediatric high grade glioma 1.400 2.1e-03
pilocytic astrocytoma 1.300 1.4e-03
sonic hedgehog group medulloblastoma 1.400 1.2e-02
aldosterone-producing adenoma -1.621 4.8e-02
ductal carcinoma in situ -1.300 8.6e-04
dermatomyositis -1.700 4.8e-04

Protein-protein Interaction (2)

Gene RIF (103)

PMID Text
26944860 High expression of hENT1 appears to predict a good response to decitabine and a prolonged survival in higher-risk myelodysplastic syndrome patients treated with decitabine.
26431496 Studies indicate that an autophagy response induced by hepatitis C virus (HCV) in a cell culture reduces ribavirin (RBV) uptake and antiviral activity by diminishing the surface expression of nucleoside transporters) member 1 (ENT1).
26406980 The Role of Flexible Loops in Folding, Trafficking and Activity of Equilibrative Nucleoside Transporters.
26279293 The identification of ITPA protective and SLC29A1 risk genotypes still appears to be a current methodology in Ribavirin dosing during hepatitis C virus therapy with direct acting antiviral agents
26083014 RNA expression of deoxycytidine kinase (DCK), human equilibrative nucleoside transporter-1 (ENT1) and ribonucleotide reductase M1 (RRM1) were significantly higher and cytidine deaminase (CDA) was significantly lower in ex vivo Ara-C sensitive samples.
26040919 SNPS in SLC29A1 were not associated with increased risk of post-traumatic epilepsy development after brain injury.
25906447 ENT1 expression profile did not serve as a useful prognostic biomarker and therapeutic target for surgically resected patients with ampullary carcinoma.
25896650 results establish Augustine as a new blood group system and place SLC29A1 as a new candidate gene for idiopathic disorders characterized with ectopic calcification/mineralization.
25725289 Adenosine A1 receptor activation increases ENT1 activity via protein kinase C.
25533931 These findings indicate that the decitabine metabolic pathway affects its therapeutic effects, lower hENT1 expression may induce primary resistance and down-regulated DCK expression may be related to secondary resistance.
25490964 Brains from patients with drug-resistant temporal lobe epilepsy had higher levels of ENT1 than controls.
25398670 Acute myeloid leukemia patients with low activity of SLC29A1 genotype have shorter disease-free and overall survival in Ara-C based therapy.
25199538 RECPAM analysis showed that DCK and CHOP were most relevant variables for the identification of patients with different mortality risk, while hENT1 and CHOP were able to identify subgroups of patients with different disease progression risk
25032731 High intratumoural hENT1 and low RRM1 expression were independently associated with prolonged disease-free survival in cholangiocarcinoma patients treated with adjuvant gemcitabine-based chemotherapy.
24857044 Study found no evidence supporting the use of hENT1 as a predictive biomarker for gemcitabine efficacy in patients with advanced pancreatic cancer.
24625353 meta-analysis suggests that high hENT1 expression may be associated with improved OS and DFS of pancreatic cancer patients treated with gemcitabine
24522200 Human equilibrative nucleoside transporter 1c1 and d3 (and c2) mRNAs are primarily expressed in human hepatocytes, which suggests that they may play important roles in controlling hENT1 expression levels in those cells.
24475233 A low human equilibrative nucleoside transporter1 level represents a significant and reproducible marker of adverse prognosis in pancreatic cancer receiving gemcitabine-based chemotherapy.
24361227 Genetic polymorphisms in SLC28A3, SLC29A1 and RRM1 can influence the clinical outcome of metastatic breast cancer patients treated with paclitaxel-gemcitabine chemotherapy.
24280569 potential prognostic and predictive role of SLC29A1 has been demonstrated for selected subset of patients--{REVIEW}
24152955 Studies indicate that high expression of nucleoside transporter subunits 1 (hENT1) in pancreaticobiliary (PB) cancer patients receiving GEM-based adjuvant therapy is associated with improved overall survival and disease-free survival.
23846918 Studies indicate that HENT1 and SPARC expression seem to be useful predictive factors of response to chemotherapy in pancreatic cancer.
23703920 findings implicate ENT1 in liver protection from ischemia and reperfusion injury and suggest ENT inhibitors may be of benefit in the prevention or treatment of ischemic liver injury
23639800 Data suggest that SLC29A1 is located on basolateral membrane of adult Sertoli cells; SLC29A1 is primarily responsible for basolateral nucleoside uptake into Sertoli cells. In contrast, SLC29A2 is localized to apical membrane of Sertoli cells.
23590299 these findings reveal the transcriptional repression of ENT1,2 as an innate protective response during acute pulmonary inflammation.
23492684 hENT1 and Notch3 mRNA expressions in biopsy specimens were the key predictive biomarkers of gemcitabine effect and gemcitabine sensitivity in patients with unresectable pancreatic ductal carcinoma.
23095574 It was confirmed that wild-type for single nucleotide polymorpismss rs6932345 and rs747199 showed higher SLC29A1 mRNA expression in peripheral blood mononuclear cells.
22985987 proliferating regions of tumors show increased FLT uptake and higher ENT1 levels than nonproliferating tumor regions
22837314 an allosteric interaction between the fifth intracellular loop and the extracellular nitrobenzylmercaptopurine riboside binding domain and implicates this region in the translocation function of human ENT1.
22705007 High levels of hENT1 in pancreatic ductal adenocarcinoma predict longer survival times in patients treated with adjuvant gemcitabine.
22644860 ENT1-mediated uptake of gemcitabine might compensate for the total uptake of gemcitabine; therefore, the variation in the apparent accumulation of gemcitabine is smaller than that of the individual transporters.
22349506 PPARalpha and PPARgamma activation modulate hENT1 expression
22314683 ENT1 expression is decreased in the superior temporal gyrus in patients with schizophrenia, demonstrating altered glutamate transport in this illness.
22212648 The SNP at the major ribavirin transporter ENT1 gene SLC29A1 was one of significantly independent factors influencing treatment response.
21898089 Study provided evidence that intratumoral HENT1 expression was an independent prognostic factor for the gemitacine-based chemoradiotherapy against pancreatic adenocarcinoma.
21822668 Data show that ENT1, ENT2, ENT4 and CNT3 protein was detected on ovarian carcinoma cells in all effusions, with expression observed in 1-95% of tumor cells.
21795683 Nucleobase transport by human equilibrative nucleoside transporter 1 (hENT1).
21678404 Role of ENT1 as a modulator of EMT in proximal tubular cells. ENT1 could be involved in renal protection processes, and the loss or reduced expression of ENT1 would lead to an increased vulnerability of cells to renal fibrosis.
21645551 The data of this study indicated that the difference in ENT1 function between wild type and heterozygous mice was greater than that between heterozygous and homozygous mice.
21455275 Results investigate the structure of the large intracellular loop of equilibrative nucleoside transporter 1 between transmembrane domains 6 and 7, and describe a method for the successful overexpression of full-length human ENT1 in a bacterial system.
21395582 This study provided evidence that neuronal ENTs reduce hypoxia- and ischemia-induced increases in extracellular adenosine levels and suggest that inhibition of neuronal adenosine transporters may be a target for the treatment of cerebral ischemia.
21336182 High hENT1 is associated with response to pemetrexed-gemcitabine combination in patients with advanced non-small cell lung cancer.
21283641 a potential contribution of a genetic variant of ENT1 to the development of alcoholism with increased risk of alcohol withdrawal-induced seizures in humans.
21264835 Low expression of hENT-1 was associated with worse OS and PFS in patients with resected pancreatic adenocarcinoma independent of gemcitabine therapy.
20883780 hENT1 is the most abundantly expressed nucleoside transporter, with highest expression levels in the aorta.
20839414 a key role of hENT1 in tumour growth of ampullary carcinoma
20814156 trans-stimulated uptake of [3H]uridine at ice-cold temperatures was inhibited by ENT1 inhibitors/substrates
20812847 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20734919 variability in hCNT1 and hENT1 expression in tumour and normal human breast tissue with different expression patterns related to patient prognosis and clinical outcome.
20720035 Nucleoside transporters are important mediators of (18)F-FLT uptake in normal and transformed cells.
20665488 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20608756 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20392501 Observational study of gene-disease association. (HuGE Navigator)
20185188 ENT1, but not ENT2 or CNTs, is a major ribavirin uptake transporter in human hepatocytes
20113503 data show that the endogenous host erythrocyte transporters ENT1 and FNT1, rather than the parasite-induced new permeation pathway, are the major route of entry of purine into Plasmodium falciparum parasitized erythrocytes
20032083 The hCHOP-C/EBPalpha complex down-regulates SLC29A1 expression in an NO-dependent manner in vascular endothelial cells from gestational diabetes
20028759 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19853583 FLT3-ITD specifically induces ara-C resistance in leukemic cells by the repression of ENT1 expression.
19801629 analysis of inhibition of the equilibrative nucleoside transporter 1 and activation of A2A adenosine receptors by 8-(4-chlorophenylthio)-modified cAMP analogs and their hydrolytic products
19428333 In vitro ara-CTP production by phoshorylation of cytarabine and mRNA levels of hENT1 were compared in HL60 cells
19349719 Expression of hENT1 was significantly lower in beta-thalassemic cells
19318496 Pancreatic adenocarcinoma patients with a high expression of hENT1 and hCNT3 immunostaining have a significantly longer survival after adjuvant gemcitabine-based chemoradiation
19297449 This evidence suggested that apical CNT3 and basolateral ENT2 are involved in proximal tubular reabsorption of adenosine and some nucleoside drugs and that apical ENT1 is involved in proximal tubular secretion of 2'-deoxyadenosine.
19222701 Human ENT1 transgenic mice exhibit increased expression and function of ENT1 in brain, accompanied by an increased behavioral response to ethanol and a decreased response to caffeine.
19193655 down-regulated by activation of TbetaRII by TGF-beta1 in endothelium from umbilical veins
19164463 Our modeling of ribavirin in erythrocytes on long-term administration of ribavirin suggests that the accumulation of ribavirin inside the cells is dependent on ENT1/Ent1 transport
19116148 These results define G24 as critical amino acid for ENT1 nucleoside uptake and suggest that mutations in TM1 may provide a mechanism for Ara-C resistance in CCRF-CEM Ara-C/8C cells.
18703227 hPMEC from pre-eclampsia exhibit increased total transport (hENT1+hENT2), and maximal velocity (Vmax) for hENT2- (2-fold), but reduced Vmax for hENT1-mediated adenosine transport
18635603 Report expression and hepatobiliary transport characteristics of ENT1 in sandwich-cultured human hepatocytes.
18600541 In NSCLC and normal tissues expression of hENT1 and hCNT1 ranged from completely negative to high.
18462193 Data suggest that in ENT1, Trp29 is positioned close to Met33, implicated in nucleoside and inhibitor recognition, and that Trp29 forms part of, or lies close to, the binding sites for dipyridamole, dilazep, NBMPR, soluflazine and draflazine.
18187485 On univariate analysis, overexpression of hENT1 was associated with shorter overall survival.
18064606 Reduced hENT1-mediated adenosine transport in high D-glucose may result from increased Sp1 binding to SLC29A1 promoter down-regulating hENT1 expression.
17926640 These data suggest that selected genes of the SLC28 and SLC29 families are not only targets of HIV-1 infection, but might also contribute to the development of adipose tissue alterations leading to lipodystrophy.
17921321 Human cardiac microvascular endothelial cells rely on ENT1 for nucleoside transport with little contribution from ENT2.
17658213 The absence of human equilibrative nucleoside transporter 1 expression predicts nonresponse to gemcitabine-containing chemotherapy in non-small cell lung cancer
17409283 transcripts for ENT1 protein in human kidneys and in cultured proximal tubule cells suggest involvement of ENT1 in renal handling of nucleosides and nucleoside drugs
17162590 Putative consensus sites for transcription factors exist within the hENT1 promoter.
16858130 Findings provide fundamental and useful information for genotyping SLC29a1 in Japanese and probably other Asian populations.
16818276 role of ENT1 in nucleoside-derived drug bioavailability and action in mantle cell lymphoma
16818266 role of ENT1 in nucleoside-derived drug bioavailability and action in mantle cell lymphoma
16688763 Nitric oxide reduces SLC29A1 promoter activity in fetal endothelium from gestational diabetes.
16609362 Functional single nucleotide polymorphism haplotypes were identified in ENT1.
16595656 analysis of interspecies differences in the mitochondrial targeting signal of the equilibrative nucleoside transporter 1
16333246 decreased expression of human equilibrative nucleoside transporter, which transports ara-C across the cell membrane, appears to be a major factor in ara-C resistance in childhood AML
15933265 hypoxia-increased extracellular adenosine may result from reduced hENT1-adenosine transport in HUVEC.
15649894 the corresponding residues in TMs 1 and 11 of hENT1, hENT2, and CeENT1 are important for dipyridamole interactions and nucleoside transport.
15632314 The down-regulation of the ENT1 gene is expected to result in nucleotide deficiency in addition to blockage of Ara-C influx.
15557207 Transmembrane domains of human ENT1 interact and are important in conferring sensitivity to NBMPR.
15529184 hENT1 was most frequently found in benign and malignant follicular center cells.
14759222 An amino acid residue (Leu92) of hENT1, when mutated, selectively alters the affinity of hENT1 to transport the nucleosides inosine and guanosine and its sensitivity to the inhibitors NBMPR and dilazep.
14607828 ENT1 is expressed on the mitochondrial membrane and enhances the mitochondrial toxicity of nucleoside drugs such as FIAU
12820662 Equilibrative nucleoside transporters (hENT1, hENT2) together with adenosine kinase and 5'-nucleotidase play a crucial role in the regulation of CFTR through an adenosine-dependent pathway in human airway epithelia.
12527552 hENT1 and hENT2 on the basolateral membrane function with concentrative nucleoside transporters on the apical membrane to mediate active reabsorption of nucleosides within the kidney.
12389626 an immunohistochemical method to assess the ENT1 abundance of cells in tumor tissue was used to study ENT1 differential expression in Reed-Sternberg cells of Hodgkin's disease
12097333 hCNT1 and hENT1 are expressed in polarized MDCK cells on the apical and basolateral membrane, respectively, allowing vectorial transport in both directions depending on the relative activity of each transporter for their substrates
12008078 Expression of 5NT and reduced hENT1 in leukemic blasts at diagnosis are correlated with clinical outcome and may play a role in resistance mechanisms to ara-C in patients with AML.
12006583 role in functional and molecular characterization of nucleobase transport
11814344 When ENT1 is expressed in yeast, glycine residue 179 is critical not only to the ability of ENT1 to transport uridine but also as a determinant of ENT1 sensitivity to inhibition by nitrobenzylthioinosine.

AA Sequence

MTTSHQPQDRYKAVWLIFFMLGLGTLLPWNFFMTATQYFTNRLDMSQNVSLVTAELSKDAQASAAPAAPL      1 - 70
PERNSLSAIFNNVMTLCAMLPLLLFTYLNSFLHQRIPQSVRILGSLVAILLVFLITAILVKVQLDALPFF     71 - 140
VITMIKIVLINSFGAILQGSLFGLAGLLPASYTAPIMSGQGLAGFFASVAMICAIASGSELSESAFGYFI    141 - 210
TACAVIILTIICYLGLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESH    211 - 280
SIKAILKNISVLAFSVCFIFTITIGMFPAVTVEVKSSIAGSSTWERYFIPVSCFLTFNIFDWLGRSLTAV    281 - 350
FMWPGKDSRWLPSLVLARLVFVPLLLLCNIKPRRYLTVVFEHDAWFIFFMAAFAFSNGYLASLCMCFGPK    351 - 420
KVKPAEAETAGAIMAFFLCLGLALGAVFSFLFRAIV                                      421 - 456
//

Text Mined References (121)

PMID Year Title
26944860 2016 High expression of the human equilibrative nucleoside transporter 1 gene predicts a good response to decitabine in patients with myelodysplastic syndrome.
26431496 2015 ENT1 and treatment of viral diseases.
26406980 2015 The Role of Flexible Loops in Folding, Trafficking and Activity of Equilibrative Nucleoside Transporters.
26279293 2015 ITPA and SLC29A1 Genotyping for the Prediction of Ribavirin Dose Reduction in Anti-HCV Triple Therapy with Protease Inhibitors.
26083014 2015 RNA expression of genes involved in cytarabine metabolism and transport predicts cytarabine response in acute myeloid leukemia.
26040919 2015 Genetic variation in the adenosine regulatory cycle is associated with posttraumatic epilepsy development.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25906447 2015 Prognostic Value of Excision Repair Cross-Complementing Gene 1, Dihydropyrimidine Dehydrogenase, and Human Equilibrative Nucleotide Transporter 1 Expression and Their Implications for Adjuvant Treatment in Patients With Ampullary Carcinoma.
25896650 2015 Lack of the nucleoside transporter ENT1 results in the Augustine-null blood type and ectopic mineralization.
25725289 2015 Adenosine A1 receptor activation modulates human equilibrative nucleoside transporter 1 (hENT1) activity via PKC-mediated phosphorylation of serine-281.
25533931 2015 The hENT1 and DCK genes underlie the decitabine response in patients with myelodysplastic syndrome.
25490964 2015 ENT1 inhibition attenuates epileptic seizure severity via regulation of glutamatergic neurotransmission.
25398670 2014 SLC29A1 single nucleotide polymorphisms as independent prognostic predictors for survival of patients with acute myeloid leukemia: an in vitro study.
25199538 2014 Modeling interactions between Human Equilibrative Nucleoside Transporter-1 and other factors involved in the response to gemcitabine treatment to predict clinical outcomes in pancreatic ductal adenocarcinoma patients.
25032731 2014 Concurrent analysis of human equilibrative nucleoside transporter 1 and ribonucleotide reductase subunit 1 expression increases predictive value for prognosis in cholangiocarcinoma patients treated with adjuvant gemcitabine-based chemotherapy.
24857044 2014 Human equilibrative nucleoside transporter 1 is not predictive for gemcitabine efficacy in advanced pancreatic cancer: translational results from the AIO-PK0104 phase III study with the clone SP120 rabbit antibody.
24625353 2014 Human equilibrative nucleoside transporter 1 predicts survival in patients with pancreatic cancer treated with gemcitabine: a meta-analysis.
24522200 2014 Identification of primary equilibrative nucleoside transporter 1 mRNA isoforms resulting from alternative promoter usage in human hepatocytes.
24475233 2014 Prognostic value of human equilibrative nucleoside transporter1 in pancreatic cancer receiving gemcitabin-based chemotherapy: a meta-analysis.
24361227 2014 Genetic polymorphisms of SLC28A3, SLC29A1 and RRM1 predict clinical outcome in patients with metastatic breast cancer receiving gemcitabine plus paclitaxel chemotherapy.
24280569 Human equilibrative nucleoside transporter 1 (hENT1): do we really have a new predictive biomarker of chemotherapy outcome in pancreatic cancer patients?
24152955 2013 A meta-analysis of gemcitabine biomarkers in patients with pancreaticobiliary cancers.
23846918 2013 Prognostic factors in pancreatic cancer.
23703920 2013 Equilibrative nucleoside transporter (ENT)-1-dependent elevation of extracellular adenosine protects the liver during ischemia and reperfusion.
23639800 2013 Basolateral uptake of nucleosides by Sertoli cells is mediated primarily by equilibrative nucleoside transporter 1.
23590299 2013 Repression of the equilibrative nucleoside transporters dampens inflammatory lung injury.
23492684 2013 Human equilibrative nucleoside transporter 1 and Notch3 can predict gemcitabine effects in patients with unresectable pancreatic cancer.
23219802 2013 Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23095574 2013 Impact of solute carrier family 29 member 1 (SLC29A1) single nucleotide polymorphisms on mRNA expression in peripheral blood mononuclear cells.
22985987 2012 Levels of human equilibrative nucleoside transporter-1 are higher in proliferating regions of A549 tumor cells grown as tumor xenografts in vivo.
22837314 2012 Cysteine residues in the transmembrane (TM) 9 to TM11 region of the human equilibrative nucleoside transporter subtype 1 play an important role in inhibitor binding and translocation function.
22705007 2012 Levels of gemcitabine transport and metabolism proteins predict survival times of patients treated with gemcitabine for pancreatic adenocarcinoma.
22644860 2012 Variability of gemcitabine accumulation and its relationship to expression of nucleoside transporters in peripheral blood mononuclear cells.
22349506 2012 PPAR? and PPAR? regulate the nucleoside transporter hENT1.
22314683 2012 Expression of equilibrative nucleoside transporter type 1 protein in elderly patients with schizophrenia.
22212648 2012 Contribution of ribavirin transporter gene polymorphism to treatment response in peginterferon plus ribavirin therapy for HCV genotype 1b patients.
21898089 2012 Human equilibrative nucleoside transporter 1 expression is a strong independent prognostic factor in UICC T3-T4 pancreatic cancer patients treated with preoperative gemcitabine-based chemoradiotherapy.
21822668 2012 Nucleoside transporters are widely expressed in ovarian carcinoma effusions.
21795683 2011 Nucleobase transport by human equilibrative nucleoside transporter 1 (hENT1).
21678404 2012 New role of the human equilibrative nucleoside transporter 1 (hENT1) in epithelial-to-mesenchymal transition in renal tubular cells.
21645551 2011 Behavioral effects of elevated expression of human equilibrative nucleoside transporter 1 in mice.
21455275 2011 Analysis of recombinant tagged equilibrative nucleoside transporter 1 (ENT1) expressed in E. coli.
21395582 2011 Expression of human equilibrative nucleoside transporter 1 in mouse neurons regulates adenosine levels in physiological and hypoxic-ischemic conditions.
21336182 2011 Optimizing pemetrexed-gemcitabine combination in patients with advanced non-small cell lung cancer: a pharmacogenetic approach.
21283641 2011 Functional role of the polymorphic 647 T/C variant of ENT1 (SLC29A1) and its association with alcohol withdrawal seizures.
21264835 2011 Prognostic roles of human equilibrative transporter 1 (hENT-1) and ribonucleoside reductase subunit M1 (RRM1) in resected pancreatic cancer.
20883780 2010 Nucleoside transporter expression profiles in human cardiac tissue show striking individual variability with overall predominance of hENT1.
20839414 2010 Human equilibrative nucleoside transporter 1 and carcinoma of the ampulla of Vater: expression differences in tumour histotypes.
20814156 2010 Human erythrocyte nucleoside transporter ENT1 functions at ice-cold temperatures.
20812847 2010 Influence of a single nucleotide polymorphism at the main ribavirin transporter gene on the rapid virological response to pegylated interferon-ribavirin therapy in patients with chronic hepatitis C virus infection.
20734919 2010 The differential expression of hCNT1 and hENT1 i n breast cancer and the possible impact on breast cancer therapy.
20720035 2010 Biodistribution and uptake of 3'-deoxy-3'-fluorothymidine in ENT1-knockout mice and in an ENT1-knockdown tumor model.
20665488 2010 Gemcitabine metabolic and transporter gene polymorphisms are associated with drug toxicity and efficacy in patients with locally advanced pancreatic cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20608756 2010 Population pharmacokinetics of gemcitabine and its metabolite in Japanese cancer patients: impact of genetic polymorphisms.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20392501 2010 Contribution of adenosine related genes to the risk of depression with disturbed sleep.
20185188 2010 Characterization of ribavirin uptake systems in human hepatocytes.
20113503 2010 Uptake of purines in Plasmodium falciparum-infected human erythrocytes is mostly mediated by the human equilibrative nucleoside transporter and the human facilitative nucleobase transporter.
20032083 2010 Nitric oxide reduces SLC29A1 promoter activity and adenosine transport involving transcription factor complex hCHOP-C/EBPalpha in human umbilical vein endothelial cells from gestational diabetes.
20028759 2010 Single nucleotide polymorphisms of gemcitabine metabolic genes and pancreatic cancer survival and drug toxicity.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19853583 2009 FLT3-ITD induces ara-C resistance in myeloid leukemic cells through the repression of the ENT1 expression.
19801629 2009 Inhibition of the equilibrative nucleoside transporter 1 and activation of A2A adenosine receptors by 8-(4-chlorophenylthio)-modified cAMP analogs and their hydrolytic products.
19428333 2009 Intracellular cytarabine triphosphate production correlates to deoxycytidine kinase/cytosolic 5'-nucleotidase II expression ratio in primary acute myeloid leukemia cells.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19349719 2009 Decreased nucleoside transport and hENT1 transporter expression in beta-thalassemia major.
19318496 2009 Human equilibrative nucleoside transporter 1 and human concentrative nucleoside transporter 3 predict survival after adjuvant gemcitabine therapy in resected pancreatic adenocarcinoma.
19297449 2009 Transepithelial fluxes of adenosine and 2'-deoxyadenosine across human renal proximal tubule cells: roles of nucleoside transporters hENT1, hENT2, and hCNT3.
19222701 2009 Transgenic expression of human equilibrative nucleoside transporter 1 in mouse neurons.
19193655 2009 TGF-beta1 inhibits expression and activity of hENT1 in a nitric oxide-dependent manner in human umbilical vein endothelium.
19164463 2009 The role of the equilibrative nucleoside transporter 1 (ENT1) in transport and metabolism of ribavirin by human and wild-type or Ent1-/- mouse erythrocytes.
19116148 2009 Identification of a novel point mutation in ENT1 that confers resistance to Ara-C in human T cell leukemia CCRF-CEM cells.
18703227 2008 Human equilibrative nucleoside transporters 1 and 2 may be differentially modulated by A2B adenosine receptors in placenta microvascular endothelial cells from pre-eclampsia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18635603 2008 Expression and hepatobiliary transport characteristics of the concentrative and equilibrative nucleoside transporters in sandwich-cultured human hepatocytes.
18600541 2008 Immunocytochemical detection of hENT1 and hCNT1 in normal tissues, lung cancer cell lines, and NSCLC patient samples.
18462193 2008 Mutation of Trp29 of human equilibrative nucleoside transporter 1 alters affinity for coronary vasodilator drugs and nucleoside selectivity.
18187485 2008 Human equilibrative nucleoside transporter 1 (hENT1) protein is associated with short survival in resected ampullary cancer.
18064606 2008 High D-glucose reduces SLC29A1 promoter activity and adenosine transport involving specific protein 1 in human umbilical vein endothelium.
17926640 2007 Altered expression of nucleoside transporter genes (SLC28 and SLC29) in adipose tissue from HIV-1-infected patients.
17921321 2007 Nucleoside and nucleobase transporters of primary human cardiac microvascular endothelial cells: characterization of a novel nucleobase transporter.
17658213 2007 The absence of human equilibrative nucleoside transporter 1 expression predicts nonresponse to gemcitabine-containing chemotherapy in non-small cell lung cancer.
17409283 2007 Localization of broadly selective equilibrative and concentrative nucleoside transporters, hENT1 and hCNT3, in human kidney.
17162590 2007 Characterization and functional analysis of the promoter for the human equilibrative nucleoside transporter gene, hENT1.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16858130 2006 Thirty novel genetic variations in the SLC29A1 gene encoding human equilibrative nucleoside transporter 1 (hENT1).
16818276 2006 Expression of human equilibrative nucleoside transporter 1 (hENT1) and its correlation with gemcitabine uptake and cytotoxicity in mantle cell lymphoma.
16818266 2006 Correlation of hENT1 expression and function with gemcitabine cytotoxicity in mantle cell lymphoma lines and clinical samples.
16688763 2006 Nitric oxide reduces adenosine transporter ENT1 gene (SLC29A1) promoter activity in human fetal endothelium from gestational diabetes.
16609362 2006 Functional single nucleotide polymorphism haplotypes in the human equilibrative nucleoside transporter 1.
16595656 2006 Identification of the mitochondrial targeting signal of the human equilibrative nucleoside transporter 1 (hENT1): implications for interspecies differences in mitochondrial toxicity of fialuridine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16333246 2005 The human equilibrative nucleoside transporter 1 mediates in vitro cytarabine sensitivity in childhood acute myeloid leukaemia.
15933265 2005 Equilibrative nucleoside transporter 1 expression is downregulated by hypoxia in human umbilical vein endothelium.
15649894 2005 Identification and mutational analysis of amino acid residues involved in dipyridamole interactions with human and Caenorhabditis elegans equilibrative nucleoside transporters.
15632314 2004 Gene-expression profiling reveals down-regulation of equilibrative nucleoside transporter 1 (ENT1) in Ara-C-resistant CCRF-CEM-derived cells.
15557207 2005 Residues Met89 and Ser160 in the human equilibrative nucleoside transporter 1 affect its affinity for adenosine, guanosine, S6-(4-nitrobenzyl)-mercaptopurine riboside, and dipyridamole.
15529184 2005 Analysis of human equilibrative nucleoside transporter 1 (hENT1) protein in non-Hodgkin's lymphoma by immunohistochemistry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759222 2004 Mutation of leucine-92 selectively reduces the apparent affinity of inosine, guanosine, NBMPR [S6-(4-nitrobenzyl)-mercaptopurine riboside] and dilazep for the human equilibrative nucleoside transporter, hENT1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14607828 2004 Mitochondrial expression of the human equilibrative nucleoside transporter 1 (hENT1) results in enhanced mitochondrial toxicity of antiviral drugs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12820662 2003 Coupling of CFTR-mediated anion secretion to nucleoside transporters and adenosine homeostasis in Calu-3 cells.
12527552 2003 Localization of human equilibrative nucleoside transporters, hENT1 and hENT2, in renal epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12389626 2002 Differential expression of human equilibrative nucleoside transporter 1 (hENT1) protein in the Reed-Sternberg cells of Hodgkin's disease.
12384580 2002 Comparative genomic analysis of equilibrative nucleoside transporters suggests conserved protein structure despite limited sequence identity.
12097333 2002 Simultaneous expression of hCNT1-CFP and hENT1-YFP in Madin-Darby canine kidney cells. Localization and vectorial transport studies.
12006583 2002 Functional and molecular characterization of nucleobase transport by recombinant human and rat equilibrative nucleoside transporters 1 and 2. Chimeric constructs reveal a role for the ENT2 helix 5-6 region in nucleobase translocation.
11584005 2001 Topology of a human equilibrative, nitrobenzylthioinosine (NBMPR)-sensitive nucleoside transporter (hENT1) implicated in the cellular uptake of adenosine and anti-cancer drugs.
10755314 2000 Human intestinal es nucleoside transporter: molecular characterization and nucleoside inhibitory profiles.
9396714 1997 Molecular cloning and characterization of a nitrobenzylthioinosine-insensitive (ei) equilibrative nucleoside transporter from human placenta.
9344680 1997 Assignment of the human equilibrative nucleoside transporter (hENT1) to 6p21.1-p21.2.
8986748 1997 Cloning of a human nucleoside transporter implicated in the cellular uptake of adenosine and chemotherapeutic drugs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.