Property Summary

NCBI Gene PubMed Count 42
PubMed Score 46.30
PubTator Score 62.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -4.969 1.0e-10
intraductal papillary-mucinous adenoma (... -3.000 4.9e-03
colon cancer 2.300 5.8e-03
active Crohn's disease 3.364 1.2e-03
active ulcerative colitis 3.848 5.8e-03
diabetes mellitus 1.300 1.0e-03
lung adenocarcinoma 1.600 8.5e-10
posterior fossa group B ependymoma 2.500 4.8e-06
psoriasis 1.400 8.4e-86
nasopharyngeal carcinoma 1.300 2.6e-02
Breast cancer -4.700 4.2e-15
ovarian cancer -2.900 6.5e-05
pituitary cancer -1.100 3.4e-02

Gene RIF (34)

PMID Text
26481311 The co-expression of galectin-4 and CNT3 proteins is not impaired in inflamed colon from patients with Crohn's disease, thereby anticipating the integrity of this system for drug targeting.
26188009 Genome-wide association analysis on normal hearing function identifies PCDH20 and SLC28A3 as good candidates for modulatory genes in the auditory system. [meta-analysis]
25955569 Results show that high CNT3 expression level is associated with overall favorable outcomes and is predictive of clinical outcomes in acute myeloid leukemia patients with t(8;21).
24361227 Genetic polymorphisms in SLC28A3, SLC29A1 and RRM1 can influence the clinical outcome of metastatic breast cancer patients treated with paclitaxel-gemcitabine chemotherapy.
24300978 The presence of homozygous major allele for SLC28A3 (CC genotype) were each associated with an almost two-fold increase in the formation clearance of dFdCTP.
23441093 Validation of variants in SLC28A3 and UGT1A6 as genetic markers predictive of anthracycline-induced cardiotoxicity in children.
23195617 association between ribavirin (RBV) serum levels and SLC28A2 rs11854484 genotype, as well as the replicated association of ITPA and SLC28A3 genetic polymorphisms with RBV-induced anemia and treatment response
21822668 Data show that ENT1, ENT2, ENT4 and CNT3 protein was detected on ovarian carcinoma cells in all effusions, with expression observed in 1-95% of tumor cells.
21346688 A genetic variant in SCL28A3 coding for the concentrative nucleoside transporter 3 protects patients with chronic hepatitis C against hemolytic anemia without affecting sustained virological response in hepatitis C virus genotype 1.
20643903 Acidic and hydrophobic motifs in the N terminus tail of the hCNT3 control ER export and cell surface expression levels in nonpolarized cells, whereas a putative beta-turn domain contributes to hCNT3 polarized surface expression in epithelial cells.
20495821 H+ drives uridine and adenosine transport by hCNT3 with lower affinity but higher maximal transport rate than Na+.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20172853 TGF-beta1 acts through activation of ERK1/2 and the small GTPase RhoA to promote plasma membrane trafficking of the hCNT3 protein.
20028759 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19380587 identified two conserved pore-lining glutamate residues (Glu-343 and Glu-519) with essential roles in CNT3 Na(+)/nucleoside and H(+)/nucleoside cotransport
19380585 identified residues of functional importance and with a revised 15-TM membrane architecture, suggest a novel membrane-associated topology for a region of the protein (TM 11A) that includes the highly conserved CNT family motif (G/A)XKX(3)NEFVA(Y/M/F)
19318496 Pancreatic adenocarcinoma patients with a high expression of hENT1 and hCNT3 immunostaining have a significantly longer survival after adjuvant gemcitabine-based chemoradiation
19297449 This evidence suggested that apical CNT3 and basolateral ENT2 are involved in proximal tubular reabsorption of adenosine and some nucleoside drugs and that apical ENT1 is involved in proximal tubular secretion of 2'-deoxyadenosine.
19074885 Observational study of gene-disease association. (HuGE Navigator)
18827020 The isolation and charcterization of an alternatively spliced SLC28A3-related mRNA is reported.
18621735 a pivotal functional role for Cys-561 in Na+- as well as H+-coupled modes of hCNT3 nucleoside transport
18199742 identified a C-terminal intramembranous cysteine residue of hCNT3 (Cys-561) that reversibly binds the hydrophilic thiol-reactive reagent p-chloromercuribenzene sulfonate (PCMBS)
17993510 A polymorphic variant of the human concentrative nucleoside transporter, CNT3, is found that severely affects its functionality.
17926640 These data suggest that selected genes of the SLC28 and SLC29 families are not only targets of HIV-1 infection, but might also contribute to the development of adipose tissue alterations leading to lipodystrophy.
17696452 This study shows that adenosine elimination on human airway epithelia is mediated by ADA1, CNT2, and CNT3, which constitute important regulators of adenosine-mediated inflammation.
17453413 hCNT2 shares common cation specificity and coupling characteristics with hCNT1, which differ markedly from those of hCNT3.
17412768 CNT3 was inserted into the apical membrane, thus generating, a transepithelial flux of both nucleosides and nucleoside-derived drugs.
17409283 transcripts for CNT3 protein in human kidneys and in cultured proximal tubule cells suggest involvement of CNT3 in renal handling of nucleosides and nucleoside drugs
16446384 Minimal features required for human CNT3 transport are two hydrogen bond acceptors at 3'-OH and 5'-O and the hydrophobic center occupied by the base ring.
16271041 The effects of cysteine substitution mutants spanning transmembrane domains 11-13 on the transport activity of CNT3 expressed in S. cerevisiae are reported.
15870078 hCNT3 possesses two Na+-binding sites, only one of which is shared by H+
15861042 examination of single nucleotide polymorphisms in the coding regions of the hCNT3 gene
15738947 genetic analysis and functional characterization of CNT3 variants suggest that this transporter does not tolerate nonsynonymous changes and is important for human fitness
14504928 hCNT3 gene is evolutionarily conserved with hCNT1 and hCNT2. Physiologically, hCNT3 is a glycoprotein, which transports purine and pyrimidine nucleosides in a Na-dependent manner with high affinities.

AA Sequence

MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHM      1 - 70
EDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIF     71 - 140
FVVWDHLMAKYEHRIDEMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMY    141 - 210
IVLLFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASFVFGEKYK    211 - 280
DHFFAFKVLPIVVFFSTVMSMLYYLGLMQWIIRKVGWIMLVTTGSSPIESVVASGNIFVGQTESPLLVRP    281 - 350
YLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKN    351 - 420
AMKMESGDSGNLLEAATQGASSSISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIF    421 - 490
MPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKFVNGVQQYISIRSEIIATYAL    491 - 560
CGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTVACFMTACIAGILSSTPVDINCHHVLENAFN    561 - 630
STFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNTF             631 - 691
//

Text Mined References (45)

PMID Year Title
26481311 2016 Galectin-4 interacts with the drug transporter human concentrative nucleoside transporter 3 to regulate its function.
26188009 2015 Genome-wide association analysis on normal hearing function identifies PCDH20 and SLC28A3 as candidates for hearing function and loss.
25955569 2015 Concentrative nucleoside transporter 3 as a prognostic indicator for favorable outcome of t(8;21)-positive acute myeloid leukemia patients after cytarabine-based chemotherapy.
24361227 2014 Genetic polymorphisms of SLC28A3, SLC29A1 and RRM1 predict clinical outcome in patients with metastatic breast cancer receiving gemcitabine plus paclitaxel chemotherapy.
24300978 2014 SLC28A3 genotype and gemcitabine rate of infusion affect dFdCTP metabolite disposition in patients with solid tumours.
23918034 2014 Genome-wide association study (GWAS) for molar-incisor hypomineralization (MIH).
23441093 2013 Validation of variants in SLC28A3 and UGT1A6 as genetic markers predictive of anthracycline-induced cardiotoxicity in children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23195617 2013 Impact of genetic SLC28 transporter and ITPA variants on ribavirin serum level, hemoglobin drop and therapeutic response in patients with HCV infection.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
21822668 2012 Nucleoside transporters are widely expressed in ovarian carcinoma effusions.
21346688 2011 Role of nucleoside transporters SLC28A2/3 and SLC29A1/2 genetics in ribavirin therapy: protection against anemia in patients with chronic hepatitis C.
20643903 2010 Different N-terminal motifs determine plasma membrane targeting of the human concentrative nucleoside transporter 3 in polarized and nonpolarized cells.
20495821 2010 Effects of Na+ and H+ on steady-state and presteady-state currents of the human concentrative nucleoside transporter 3 (hCNT3).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20172853 2010 All-trans-retinoic acid promotes trafficking of human concentrative nucleoside transporter-3 (hCNT3) to the plasma membrane by a TGF-beta1-mediated mechanism.
20028759 2010 Single nucleotide polymorphisms of gemcitabine metabolic genes and pancreatic cancer survival and drug toxicity.
19380587 2009 Conserved glutamate residues Glu-343 and Glu-519 provide mechanistic insights into cation/nucleoside cotransport by human concentrative nucleoside transporter hCNT3.
19380585 2009 Substituted cysteine accessibility method analysis of human concentrative nucleoside transporter hCNT3 reveals a novel discontinuous region of functional importance within the CNT family motif (G/A)XKX3NEFVA(Y/M/F).
19318496 2009 Human equilibrative nucleoside transporter 1 and human concentrative nucleoside transporter 3 predict survival after adjuvant gemcitabine therapy in resected pancreatic adenocarcinoma.
19297449 2009 Transepithelial fluxes of adenosine and 2'-deoxyadenosine across human renal proximal tubule cells: roles of nucleoside transporters hENT1, hENT2, and hCNT3.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18827020 2009 A splice variant of the SLC28A3 gene encodes a novel human concentrative nucleoside transporter-3 (hCNT3) protein localized in the endoplasmic reticulum.
18621735 2008 A conformationally mobile cysteine residue (Cys-561) modulates Na+ and H+ activation of human CNT3.
18199742 2008 A proton-mediated conformational shift identifies a mobile pore-lining cysteine residue (Cys-561) in human concentrative nucleoside transporter 3.
17993510 2008 Functional characterization of a nucleoside-derived drug transporter variant (hCNT3C602R) showing altered sodium-binding capacity.
17926640 2007 Altered expression of nucleoside transporter genes (SLC28 and SLC29) in adipose tissue from HIV-1-infected patients.
17696452 2007 Adenosine deaminase 1 and concentrative nucleoside transporters 2 and 3 regulate adenosine on the apical surface of human airway epithelia: implications for inflammatory lung diseases.
17453413 Cation coupling properties of human concentrative nucleoside transporters hCNT1, hCNT2 and hCNT3.
17412768 2007 Role of CNT3 in the transepithelial flux of nucleosides and nucleoside-derived drugs.
17409283 2007 Localization of broadly selective equilibrative and concentrative nucleoside transporters, hENT1 and hCNT3, in human kidney.
17140564 2007 Ribavirin uptake by cultured human choriocarcinoma (BeWo) cells and Xenopus laevis oocytes expressing recombinant plasma membrane human nucleoside transporters.
16446384 2006 Electrophysiological characterization and modeling of the structure activity relationship of the human concentrative nucleoside transporter 3 (hCNT3).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16271041 2006 Cysteine-accessibility analysis of transmembrane domains 11-13 of human concentrative nucleoside transporter 3.
15870078 2005 The broadly selective human Na+/nucleoside cotransporter (hCNT3) exhibits novel cation-coupled nucleoside transport characteristics.
15861042 2005 Identification and functional characterization of variants in human concentrative nucleoside transporter 3, hCNT3 (SLC28A3), arising from single nucleotide polymorphisms in coding regions of the hCNT3 gene.
15738947 2005 Functional analysis of genetic variants in the human concentrative nucleoside transporter 3 (CNT3; SLC28A3).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14504928 2003 Genomic organization and functional characterization of the human concentrative nucleoside transporter-3 isoform (hCNT3) expressed in mammalian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11032837 2001 Molecular identification and characterization of novel human and mouse concentrative Na+-nucleoside cotransporter proteins (hCNT3 and mCNT3) broadly selective for purine and pyrimidine nucleosides (system cib).