Property Summary

NCBI Gene PubMed Count 29
PubMed Score 62.77
PubTator Score 56.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 2.300 4.8e-02
diabetes mellitus 1.100 1.1e-03

Synonym

Accession O43868 A8K7F9 O43239 Q52LZ0
Symbols CNT2
HCNT2
SPNT1
HsT17153

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (20)

PMID Text
23195617 association between ribavirin (RBV) serum levels and SLC28A2 rs11854484 genotype, as well as the replicated association of ITPA and SLC28A3 genetic polymorphisms with RBV-induced anemia and treatment response
23149444 genetic association studies in population in Italy: Data suggest that 3 SNPs (SLC28A2 rs11854484; IL28B, rs8099917; CYP27B1, rs4646536) are associated with pharmacokinetics of ribavirin and thus, sustained virologic response in hepatitis C patients.
20506327 These findings support the theory that CNT2 plays roles other than salvage and establishes links with energy metabolism.
20392501 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20028759 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19098160 Single nucleotide polymorphisms of this protein may play a role in variation in the pharmacokinetics and pharmacological effects of nucleoside analogs.
19074885 Observational study of gene-disease association. (HuGE Navigator)
18635603 Report expression and hepatobiliary transport characteristics of CNT2 in sandwich-cultured human hepatocytes.
17926640 These data suggest that selected genes of the SLC28 and SLC29 families are not only targets of HIV-1 infection, but might also contribute to the development of adipose tissue alterations leading to lipodystrophy.
17700367 Observational study of genotype prevalence. (HuGE Navigator)
17700367 Five novel nonsynonymous variants (L12R, R142H, E172D, E385K, M612T) expressed in U-251 cells revealed that all except E385K can uptake various substrates of CNT2: inosine, ribavirin and uridine.
17696452 This study shows that adenosine elimination on human airway epithelia is mediated by ADA1, CNT2, and CNT3, which constitute important regulators of adenosine-mediated inflammation.
17453413 hCNT2 shares common cation specificity and coupling characteristics with hCNT1, which differ markedly from those of hCNT3.
17187757 HNF4alpha is a major determinant of SLC28A1 expression, whereas C/EBPalpha and HNF3gamma modulate SLC28A2 gene expression.
16840788 Results identify the critical domains and amino acid residues that contribute to the observed difference in specificity between concentrative nucleoside transporter (CNT)2 orthologs.
15861032 analysis of polymorphisms in the human concentrative nucleoside transporter, CNT2
15486050 Human nucleoside transporters involved in cellular uptake of Bbenzamide riboside and tiazofurin and their role in cytotoxicity.
12893280 Characterization of sodium-dependent nucleoside transporter hCNT2 cloned from duodenum.
12110519 there are notable species differences in the specificity of SPNT for synthetic nucleoside analogs.

AA Sequence

MEKASGRQSIALSTVETGTVNPGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFC      1 - 70
KTHASLFKKILLGLLCLAYAAYLLAACILNFQRALALFVITCLVIFVLVHSFLKKLLGKKLTRCLKPFEN     71 - 140
SRLRLWTKWVFAGVSLVGLILWLALDTAQRPEQLIPFAGICMFILILFACSKHHSAVSWRTVFSGLGLQF    141 - 210
VFGILVIRTDLGYTVFQWLGEQVQIFLNYTVAGSSFVFGDTLVKDVFAFQALPIIIFFGCVVSILYYLGL    211 - 280
VQWVVQKVAWFLQITMGTTATETLAVAGNIFVGMTEAPLLIRPYLGDMTLSEIHAVMTGGFATISGTVLG    281 - 350
AFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLA    351 - 420
TNVAANLIAFLAVLAFINAALSWLGELVDIQGLTFQVICSYLLRPMVFMMGVEWTDCPMVAEMVGIKFFI    421 - 490
NEFVAYQQLSQYKNKRLSGMEEWIEGEKQWISVRAEIITTFSLCGFANLSSIGITLGGLTSIVPHRKSDL    491 - 560
SKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPS    561 - 630
FSGPWEDKEFSAMALTNCCGFYNNTVCA                                              631 - 658
//

Text Mined References (30)

PMID Year Title
23195617 2013 Impact of genetic SLC28 transporter and ITPA variants on ribavirin serum level, hemoglobin drop and therapeutic response in patients with HCV infection.
23149444 2012 Negative predictive value of IL28B, SLC28A2, and CYP27B1 SNPs and low RBV plasma exposure for therapeutic response to PEG/IFN-RBV treatment.
22229870 2012 Genome-wide association of serum uric acid concentration: replication of sequence variants in an island population of the Adriatic coast of Croatia.
20506327 2010 Link between high-affinity adenosine concentrative nucleoside transporter-2 (CNT2) and energy metabolism in intestinal and liver parenchymal cells.
20392501 2010 Contribution of adenosine related genes to the risk of depression with disturbed sleep.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20028759 2010 Single nucleotide polymorphisms of gemcitabine metabolic genes and pancreatic cancer survival and drug toxicity.
19098160 2009 Identification and characterization of proximal promoter polymorphisms in the human concentrative nucleoside transporter 2 (SLC28A2).
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18635603 2008 Expression and hepatobiliary transport characteristics of the concentrative and equilibrative nucleoside transporters in sandwich-cultured human hepatocytes.
17926640 2007 Altered expression of nucleoside transporter genes (SLC28 and SLC29) in adipose tissue from HIV-1-infected patients.
17700367 2007 Identification and functional analysis of variants in the human concentrative nucleoside transporter 2, hCNT2 (SLC28A2) in Chinese, Malays and Indians.
17696452 2007 Adenosine deaminase 1 and concentrative nucleoside transporters 2 and 3 regulate adenosine on the apical surface of human airway epithelia: implications for inflammatory lung diseases.
17453413 Cation coupling properties of human concentrative nucleoside transporters hCNT1, hCNT2 and hCNT3.
17187757 2007 Transcription factors involved in the expression of SLC28 genes in human liver parenchymal cells.
16840788 2006 Molecular determinants of specificity for synthetic nucleoside analogs in the concentrative nucleoside transporter, CNT2.
15861032 2005 Genetic analysis and functional characterization of polymorphisms in the human concentrative nucleoside transporter, CNT2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486050 2005 Role of human nucleoside transporters in the cellular uptake of two inhibitors of IMP dehydrogenase, tiazofurin and benzamide riboside.
15044622 2004 Interactions of nucleoside analogs, caffeine, and nicotine with human concentrative nucleoside transporters 1 and 2 stably produced in a transport-defective human cell line.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12893280 2003 Functional expression and characterization of a sodium-dependent nucleoside transporter hCNT2 cloned from human duodenum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411296 2003 Fludarabine uptake mechanisms in B-cell chronic lymphocytic leukemia.
11602688 2001 Differential kinetics of transport of 2',3'-dideoxyinosine and adenosine via concentrative Na+ nucleoside transporter CNT2 cloned from rat blood-brain barrier.
11162617 2001 Differential expression of human nucleoside transporters in normal and tumor tissue.
10455109 1999 Identification of amino acid residues responsible for the pyrimidine and purine nucleoside specificities of human concentrative Na(+) nucleoside cotransporters hCNT1 and hCNT2.
10087507 Molecular cloning, functional expression and chromosomal localization of a cDNA encoding a human Na+/nucleoside cotransporter (hCNT2) selective for purine nucleosides and uridine.
9435697 1997 Na(+)-dependent purine nucleoside transporter from human kidney: cloning and functional characterization.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.