Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.63
PubTator Score 7.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.200 2.3e-04
ependymoma 1.400 2.1e-09
glioblastoma 1.600 2.1e-06
intraductal papillary-mucinous adenoma (... 2.200 8.9e-03
lung adenocarcinoma -1.100 1.3e-07
lung cancer -2.300 2.7e-04
non-small cell lung cancer -1.647 8.5e-22
osteosarcoma -1.413 1.9e-02
pancreatic ductal adenocarcinoma liver m... -1.651 8.4e-04
primitive neuroectodermal tumor 1.400 5.7e-03
tuberculosis 1.800 5.4e-07

Gene RIF (5)

AA Sequence

MGVCQRTRAPWKEKSQLERAALGFRKGGSGMFASGWNQTVPIEEAGSMAALLLLPLLLLLPLLLLKLHLW      1 - 70
PQLRWLPADLAFAVRALCCKRALRARALAAAAADPEGPEGGCSLAWRLAELAQQRAAHTFLIHGSRRFSY     71 - 140
SEAERESNRAARAFLRALGWDWGPDGGDSGEGSAGEGERAAPGAGDAAAGSGAEFAGGDGAARGGGAAAP    141 - 210
LSPGATVALLLPAGPEFLWLWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEPDLP    211 - 280
ALRAMGLHLWAAGPGTHPAGISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARISHL    281 - 350
KILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQ    351 - 420
YIGELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGA    421 - 490
VGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLL    491 - 560
KDVFRPGDVFFNTGDLLVCDDQGFLRFHDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGH    561 - 630
EGRAGMAALVLRPPHALDLMQLYTHVSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSD    631 - 700
PLYVLDQAVGAYLPLTTARYSALLAGNLRI                                            701 - 730
//

Text Mined References (18)

PMID Year Title