Property Summary

NCBI Gene PubMed Count 26
PubMed Score 51.78
PubTator Score 27.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis -2.239 2.5e-02
astrocytic glioma -1.100 8.3e-03
oligodendroglioma -1.100 5.8e-03
psoriasis -2.100 3.0e-36
osteosarcoma -2.731 2.4e-04
glioblastoma -1.400 2.7e-06
medulloblastoma, large-cell 1.300 4.6e-02
Atopic dermatitis -1.500 3.0e-02
pancreatic ductal adenocarcinoma liver m... -3.930 5.5e-04
non-small cell lung cancer 1.009 5.6e-05
lung cancer 3.300 2.6e-06
interstitial cystitis -1.400 5.0e-03
pediatric high grade glioma -1.100 3.2e-05
pilocytic astrocytoma -1.100 8.8e-05
nasopharyngeal carcinoma -1.800 1.8e-06
Breast cancer 2.100 1.9e-04
pituitary cancer -1.400 6.7e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (7)

PMID Text
26284975 In mice Grassofermata decreased absorption of (13)C-oleate demonstrating its potential as a therapeutic agent.
24277691 Protective effects of breastfeeding are reflected in higher expression levels of SLC27A2, FASN, PPARalpha and INSR in blood cells.
24113382 these data support the conclusion that FATP2 has a dual function in the pathways linking the transport and activation of exogenous fatty acids.
22028793 even though hypoxia regulates the expression of FATP2 and FATP4 in human trophoblasts, mouse Fatp2 and Fatp4 are not essential for intrauterine fetal growth.
21768100 FATP2a functions in fatty acid transport and activation and provides specificity toward n-3 fatty acids in which the corresponding n-3 acyl-CoAs are preferentially trafficked into acyl-CoA pools destined for phosphatidylinositol incorporation
20965718 Observational study of gene-disease association. (HuGE Navigator)
17998437 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFLEKARQTPHKP      1 - 70
FLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRA     71 - 140
KSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESW    141 - 210
RSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCI    211 - 280
VAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFV    281 - 350
KRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG    351 - 420
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGE    421 - 490
NVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLR    491 - 560
IQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL              561 - 620
//

Text Mined References (33)

PMID Year Title
26284975 2015 Fatty acid transport protein-2 inhibitor Grassofermata/CB5 protects cells against lipid accumulation and toxicity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24277691 2014 Influence of breastfeeding on blood-cell transcript-based biomarkers of health in children.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24113382 2013 Overexpression of human fatty acid transport protein 2/very long chain acyl-CoA synthetase 1 (FATP2/Acsvl1) reveals distinct patterns of trafficking of exogenous fatty acids.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22028793 2011 The expression and function of fatty acid transport protein-2 and -4 in the murine placenta.
22022213 2011 Overexpression of CD36 and acyl-CoA synthetases FATP2, FATP4 and ACSL1 increases fatty acid uptake in human hepatoma cells.
21768100 2011 Human fatty acid transport protein 2a/very long chain acyl-CoA synthetase 1 (FATP2a/Acsvl1) has a preference in mediating the channeling of exogenous n-3 fatty acids into phosphatidylinositol.
21269460 2011 Initial characterization of the human central proteome.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17998437 2008 Candidate single-nucleotide polymorphisms from a genomewide association study of Alzheimer disease.
16781659 2006 Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980911 2002 Participation of two members of the very long-chain acyl-CoA synthetase family in bile acid synthesis and recycling.
10640429 2000 Intraperoxisomal localization of very-long-chain fatty acyl-CoA synthetase: implication in X-adrenoleukodystrophy.
10479480 1999 Human liver-specific very-long-chain acyl-coenzyme A synthetase: cDNA cloning and characterization of a second enzymatically active protein.
10471116 Human very long-chain acyl-CoA synthetase and two human homologs: initial characterization and relationship to fatty acid transport protein.
10198260 1999 Human very-long-chain acyl-CoA synthetase: cloning, topography, and relevance to branched-chain fatty acid metabolism.
9730624 1998 Assignment of human fatty-acid-coenzyme A ligase, very long-chain 1 gene (FACVL1) to human chromosome band 15q21.2 by fluorescence in situ hybridization.
9671728 1998 A family of fatty acid transporters conserved from mycobacterium to man.
8939997 1996 Molecular cloning of cDNA encoding rat very long-chain acyl-CoA synthetase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.