Property Summary

NCBI Gene PubMed Count 25
PubMed Score 19.26
PubTator Score 15.54

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
25771386 SLC26A9 single nucleotide polymorphisms modify prenatal exocrine pancreatic damage in cystic fibrosis
24272871 We have identified two SLC26A9 mutations decreasing Cl- channel transport in patients with a CF-like lung disease.
23670970 SLC26A9 is an epithelial chloride/bicarbonate channel that can interact with the CF transmembrane regulator (CFTR), the protein mutated in CF
22945630 Several SNPs in the 3' UTR of SLC26A9 (rs12031234, rs2282429, rs2282430)were associated with asthma in children with asthma.
22544634 SLC26A9 polymorphisms lead to several function modifications (increased activity, decreased activity, altered protein expression), which could lead to a spectrum of pathophysiologies.
22466613 Single nucleotide polymorphism in SLC26A9 gene is associated with cystic fibrosis.
21809345 Report functional interaction between CFTR and SLC26A9 in polarized airway epithelial cells and in non-polarized HEK293 cells.
21439353 the L683P mutation of SLC26A9 was found to reduce Cl(-) transport through SLC26A9 as well as the positive interaction exerted by SLC26A9 on CFTR ion transport activity
20658517 The interactions between SLC26A9 and CFTR were studied, and an alternative hypothesis to their known interactions is presented.
20331378 Observational study of gene-disease association. (HuGE Navigator)
19643730 These results imply that Slc26-STAS domains may all interact with (R)CFTR but that the physiological outcome is specific to differing Slc26 proteins, allowing for dynamic and acute fine tuning of ion transport for various epithelia.
19289574 Functions as an anion conductance in the apical membranes of bronchial epithelium; contributes to transepithelial chloride currents under basal and cyclic AMP/protein kinase A-stimulated conditions.
18769029 The transport properties of human SLC26A9 was studied to determine its functional and pharmacological characteristics.
17673510 SLC26A9 is a highly selective Cl(-) channel with minimal OH(-)/HCO(3)(-) permeability that is regulated by the WNK kinases.
17120765 Slc26a9 functions as an electrogenic nCl-/HCO3- exchanger, suggesting a role in pulmonary and gastric HCO3- secretion and/or CO2 transport.

AA Sequence

MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPKYKIKDY      1 - 70
IIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGVHQMVPGTFAVISILVGNICL     71 - 140
QLAPESKFQVFNNATNESYVDTAAMEAERLHVSATLACLTAIIQMGLGFMQFGFVAIYLSESFIRGFMTA    141 - 210
AGLQILISVLKYIFGLTIPSYTGPGSIVFTFIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKI    211 - 280
RFPIPTEMIVVVVATAISGGCKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLA    281 - 350
MGRTLANKHGYDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML    351 - 420
VLGIYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPYGVAVGVAFSV    421 - 490
LVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQK    491 - 560
VLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENAPPTDPNNNQTPANGTSVSYITFSPD    561 - 630
SSSPAQSEPPASAEAPGEPSDMLASVPPFVTFHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLV    631 - 700
NIHAQVYNDISHGGVFEDGSLECKHVFPSIHDAVLFAQANARDVTPGHNFQGAPGDAELSLYDSEEDIRS    701 - 770
YWDLEQEMFGSMFHAETLTAL                                                     771 - 791
//

Text Mined References (27)

PMID Year Title
25771386 2015 Variants in Solute Carrier SLC26A9 Modify Prenatal Exocrine Pancreatic Damage in Cystic Fibrosis.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24647542 2014 N-glycosylation and topology of the human SLC26 family of anion transport membrane proteins.
24272871 2013 Characterization of SLC26A9 in patients with CF-like lung disease.
23670970 2013 Genetic modifiers of cystic fibrosis-related diabetes.
22945630 2012 SLC26A9-mediated chloride secretion prevents mucus obstruction in airway inflammation.
22544634 2012 Functional analysis of nonsynonymous single nucleotide polymorphisms in human SLC26A9.
22466613 2012 Multiple apical plasma membrane constituents are associated with susceptibility to meconium ileus in individuals with cystic fibrosis.
21809345 2012 Differential contribution of SLC26A9 to Cl(-) conductance in polarized and non-polarized epithelial cells.
21439353 2011 Characterization of the L683P mutation of SLC26A9 in Xenopus oocytes.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20658517 2011 SLC26A9 stimulates CFTR expression and function in human bronchial cell lines.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19643730 2009 Slc26a9 is inhibited by the R-region of the cystic fibrosis transmembrane conductance regulator via the STAS domain.
19289574 2009 SLC26A9 is a constitutively active, CFTR-regulated anion conductance in human bronchial epithelia.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18769029 2008 Characterization of SLC26A9, facilitation of Cl(-) transport by bicarbonate.
17673510 2007 SLC26A9 is a Cl(-) channel regulated by the WNK kinases.
17120765 2006 Physiology of electrogenic SLC26 paralogues.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15800055 2005 SLC26A9 is expressed in gastric surface epithelial cells, mediates Cl-/HCO3- exchange, and is inhibited by NH4+.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11834742 2002 Functional characterization of three novel tissue-specific anion exchangers SLC26A7, -A8, and -A9.
11581495 2001 Physiological roles and regulation of mammalian sulfate transporters.