Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.56
PubTator Score 93.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic -1.300 7.3e-06
atypical teratoid / rhabdoid tumor -1.500 2.1e-05
ependymoma -1.500 1.1e-10
glioblastoma -1.200 1.3e-05
group 3 medulloblastoma -1.800 5.7e-06
medulloblastoma, large-cell -1.200 3.3e-04
osteosarcoma -3.884 2.3e-08
ovarian cancer 1.300 8.0e-07
pediatric high grade glioma -1.300 3.0e-06
primitive neuroectodermal tumor -1.900 1.7e-05

Gene RIF (10)

AA Sequence

MAQLERSAISGFSSKSRRNSFAYDVKREVYNEETFQQEHKRKASSSGNMNINITTFRHHVQCRCSWHRFL      1 - 70
RCVLTIFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVPQGLTLSLLARQLIPPLNIAYAAFCSSVIYVIF     71 - 140
GSCHQMSIGSFFLVSALLINVLKVSPFNNGQLVMGSFVKNEFSAPSYLMGYNKSLSVVATTTFLTGIIQL    141 - 210
IMGVLGLGFIATYLPESAMSAYLAAVALHIMLSQLTFIFGIMISFHAGPISFFYDIINYCVALPKANSTS    211 - 280
ILVFLTVVVALRINKCIRISFNQYPIEFPMELFLIIGFTVIANKISMATETSQTLIDMIPYSFLLPVTPD    281 - 350
FSLLPKIILQAFSLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSCVFTGAIARTII    351 - 420
QDKSGGRQQFASLVGAGVMLLLMVKMGHFFYTLPNAVLAGIILSNVIPYLETISNLPSLWRQDQYDCALW    421 - 490
MMTFSSSIFLGLDIGLIISVVSAFFITTVRSHRAKILLLGQIPNTNIYRSINDYREIITIPGVKIFQCCS    491 - 560
SITFVNVYYLKHKLLKEVDMVKVPLKEEEIFSLFNSSDTNLQGGKICRCFCNCDDLEPLPRILYTERFEN    561 - 630
KLDPEASSINLIHCSHFESMNTSQTASEDQVPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDV    631 - 700
AESQGRRSLIPYSDASLLPSVHTIILDFSMVHYVDSRGLVVLRQICNAFQNANILILIAGCHSSIVRAFE    701 - 770
RNDFFDAGITKTQLFLSVHDAVLFALSRKVIGSSELSIDESETVIRETYSETDKNDNSRYKMSSSFLGSQ    771 - 840
KNVSPGFIKIQQPVEEESELDLELESEQEAGLGLDLDLDRELEPEMEPKAETETKTQTEMEPQPETEPEM    841 - 910
EPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSVERRRHPMDSYSPEGNSNEDV              911 - 970
//

Text Mined References (22)

PMID Year Title