Property Summary

NCBI Gene PubMed Count 44
PubMed Score 1204.09
PubTator Score 49.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 2.000 1.3e-12
psoriasis -2.200 6.6e-58

Gene RIF (28)

PMID Text
26283790 anion-pi interaction is the mechanism for the voltage-dependent response of prestin
25920562 I hypothesize that serum assays of OHC specific protein, prestin, will allow detection and quantification of OHC damage before audiometric testing can identify presence of hearing loss.
24453323 Calmodulin-prestin interaction may be involved in the medial olivocochlear-mediated modulation of cochlear amplification
24138858 The effects of fast temperature jumps induced by an infrared (IR) laser in control and prestin (SLC26a5)-transfected human embryonic kidney (HEK) cells, are reproted.
23660400 COCH and SLC26A5 mRNA are expressed in specific structures and cells of the inner ear in archival human temporal bone
23542924 The findings suggest that CASK and the truncated prestin splice isoform contribute to confinement of prestin to the basolateral region of the plasma membrane.
23212912 prestin subunits are individually functional within a given multimer
21975444 This result implies that in cell membranes prestin oligomerizes to a tetramer.
21813750 Four mutations (C124A, C192A, C260A, and C415A), all in nonconserved cysteinyl residues, significantly differed in their nonlinear capacitance properties compared with wild-type prestin.
20668687 Observational study of genetic testing. (HuGE Navigator)
20471983 These data reveal that the STAS (sulfate transporters and anti-sigma factor antagonist) domain starts immediately after the last transmembrane segment and lies beneath the lipid bilayer.
19926791 Cysteine mutagenesis reveals transmembrane residues associated with charge translocation in prestin
19737539 This indicates that Met-225 in prestin somehow adjusts nonlinear capacitance and the motility of prestin-expressing cells.
19515900 Results are consistent with significant movements in the COOH-terminal domain of prestin upon change in membrane potential, providing the first dynamic information on its molecular rearrangements.
19492055 analysis of novel DNA sequence variations in SLC26A5, encoding prestin
19492055 Observational study of gene-disease association. (HuGE Navigator)
19027966 heterozygosity for the mutation IVS2-2A>G in SLC26A5 gene may not, by itself, be sufficient to cause hearing loss.
19027966 Observational study of gene-disease association. (HuGE Navigator)
18988928 Observational study of gene-disease association. (HuGE Navigator)
18567583 Results quantify the relation between membrane cholesterol concentration and prestin-associated charge movement and enhance our understanding of how membrane composition modulates prestin function.
18073211 results indicate that an evolutionarily conserved dimeric quaternary structure represents the native and functional state of SLC26 transporters
17933870 Cholesterol levels modulate the distribution of prestin within plasma membrane microdomains and affect prestin self-association
17786286 This is the first genetic and electrophysiological analysis of a human mutation in a coding exon of the pres gene by 47 patients with non-syndromic, sensorineural, mild-to-moderate hearing impairment.
17151276 Packing of helices and interactions between residues surrounding the sulfate transporter motif is essential for normal prestin activity.
16873410 Because mammals possess differentiated outer hair cells (OHC), they also benefit from a novel electromotile process, powered by the motor protein, prestin.
16086836 Observational study of genotype prevalence. (HuGE Navigator)
15660259 KCNQ4 phosphorylation via PKA and coupling to a complex that may include prestin can lead to the negative activation and the negative resting potential found in adult outer hair cells.
12719379 an essential function of prestin in human auditory processing

AA Sequence

MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKW      1 - 70
LPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVI     71 - 140
SLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLV    141 - 210
RGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNE    211 - 280
RFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVG    281 - 350
FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM    351 - 420
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLIT    421 - 490
AVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKT    491 - 560
GVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQ    561 - 630
RFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWE    631 - 700
LLFHSIHDAVLGSQLREALAEQEASAPPSQEDLEPNATPATPEA                              701 - 744
//

Text Mined References (44)

PMID Year Title
26283790 2015 Glutamate transporter homolog-based model predicts that anion-? interaction is the mechanism for the voltage-dependent response of prestin.
25920562 2015 Prestin as a biochemical marker for early detection of acquired sensorineural hearing loss.
24647542 2014 N-glycosylation and topology of the human SLC26 family of anion transport membrane proteins.
24453323 2014 Functional regulation of the SLC26-family protein prestin by calcium/calmodulin.
24138858 2013 IR laser-induced perturbations of the voltage-dependent solute carrier protein SLC26a5.
23762468 2013 Real time measures of prestin charge and fluorescence during plasma membrane trafficking reveal sub-tetrameric activity.
23665419 Prenatal smoke exposure: effects on infant auditory system and placental gene expression.
23660400 2013 RNA analysis of inner ear cells from formalin fixed paraffin embedded (FFPE) archival human temporal bone section using laser microdissection--a technical report.
23542924 2013 Generation of somatic electromechanical force by outer hair cells may be influenced by prestin-CASK interaction at the basal junction with the Deiter's cell.
23506885 The SLC26 gene family of anion transporters and channels.
23212912 2013 The V499G/Y501H mutation impairs fast motor kinetics of prestin and has significance for defining functional independence of individual prestin subunits.
21975444 2012 Prestin in HEK cells is an obligate tetramer.
21813750 2011 The roles of conserved and nonconserved cysteinyl residues in the oligomerization and function of mammalian prestin.
20668687 2010 Genotyping with a 198 mutation arrayed primer extension array for hereditary hearing loss: assessment of its diagnostic value for medical practice.
20471983 2010 Structure of the cytosolic portion of the motor protein prestin and functional role of the STAS domain in SLC26/SulP anion transporters.
19926791 2010 Cysteine mutagenesis reveals transmembrane residues associated with charge translocation in prestin.
19737539 2009 Mutation-induced reinforcement of prestin-expressing cells.
19515900 2009 Structural rearrangements of the motor protein prestin revealed by fluorescence resonance energy transfer.
19492055 2009 DNA sequence analysis of SLC26A5, encoding prestin, in a patient-control cohort: identification of fourteen novel DNA sequence variations.
19027966 2009 Splice variant IVS2-2A>G in the SLC26A5 (Prestin) gene in five Estonian families with hearing loss.
18988928 2008 Genetic analysis of presbycusis by arrayed primer extension.
18567583 2008 Membrane composition modulates prestin-associated charge movement.
18073211 2008 Conserved dimeric subunit stoichiometry of SLC26 multifunctional anion exchangers.
17933870 2007 Tuning of the outer hair cell motor by membrane cholesterol.
17786286 2007 A new mutation in the human pres gene and its effect on prestin function.
17151276 2006 Essential helix interactions in the anion transporter domain of prestin revealed by evolutionary trace analysis.
16873410 2006 Prestin and the cochlear amplifier.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16086836 2005 High frequency of the IVS2-2A>G DNA sequence variation in SLC26A5, encoding the cochlear motor protein prestin, precludes its involvement in hereditary hearing loss.
15660259 2005 Regulation of the voltage-gated potassium channel KCNQ4 in the auditory pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140192 2004 N-linked glycosylation sites of the motor protein prestin: effects on membrane targeting and electrophysiological function.
14747354 2004 Tension sensitivity of prestin: comparison with the membrane motor in outer hair cells.
12853948 2003 The DNA sequence of human chromosome 7.
12719379 2003 Prestin, a cochlear motor protein, is defective in non-syndromic hearing loss.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239568 2002 Prestin is required for electromotility of the outer hair cell and for the cochlear amplifier.
11867734 2002 Thyroid hormone is a critical determinant for the regulation of the cochlear motor protein prestin.
11836512 2002 Prestin, a new type of motor protein.
11581495 2001 Physiological roles and regulation of mammalian sulfate transporters.
11423665 2001 Intracellular anions as the voltage sensor of prestin, the outer hair cell motor protein.
11087667 2000 Mapping of five new putative anion transporter genes in human and characterization of SLC26A6, a candidate gene for pancreatic anion exchanger.
10821263 2000 Prestin is the motor protein of cochlear outer hair cells.
9847074 1998 Toward a complete human genome sequence.