Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33
PubTator Score 0.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQLYGIKTRDAVL      1 - 70
QLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFATHGVAAVLAGTAEAIFTPLER     71 - 140
VQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAH    141 - 210
LVNDFIGGGLLGAMLGFLCFPINVVKTRLQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSL    211 - 280
ISWGIINATYEFLLKFI                                                         281 - 297
//

Text Mined References (5)

PMID Year Title