Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.31
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 8.7e-03
Astrocytoma, Pilocytic -1.800 1.1e-06
atypical teratoid / rhabdoid tumor -1.600 4.2e-07
Endometriosis -2.018 3.1e-02
ependymoma -1.300 3.2e-06
glioblastoma -1.400 2.9e-05
group 4 medulloblastoma -1.600 3.3e-04
medulloblastoma, large-cell -1.900 9.6e-04
osteosarcoma 1.078 2.8e-03
primitive neuroectodermal tumor -1.700 4.7e-04
subependymal giant cell astrocytoma -1.306 2.1e-02

Gene RIF (3)

AA Sequence

MGSFQLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFKGMSFPLASIA      1 - 70
VYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLIKIRLQMQTQPFRD     71 - 140
ANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRGASAMLLRDVPGYCLYFIPYVFLSEWITPEA    141 - 210
CTGPSPCAVWLAGGMAGAISWGTATPMDVVKSRLQADGVYLNKYKGVLDCISQSYQKEGLKVFFRGITVN    211 - 280
AVRGFPMSAAMFLGYELSLQAIRGDHAVTSP                                           281 - 311
//

Text Mined References (11)

PMID Year Title