Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.06
PubTator Score 2.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 5.1e-08
glioblastoma -1.400 4.3e-06
lung carcinoma 1.800 3.1e-44
medulloblastoma -1.100 2.4e-05
medulloblastoma, large-cell -1.400 1.5e-05
non primary Sjogren syndrome sicca 1.100 2.0e-02
osteosarcoma -1.645 5.2e-07
primitive neuroectodermal tumor -1.200 3.5e-04

Gene RIF (4)

AA Sequence

MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSA      1 - 70
KEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFAGAL     71 - 140
AGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYET    141 - 210
LKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGA    211 - 280
VRGLYKGLSMNWVKGPIAVGISFTTFDLMQILLRHLQS                                    281 - 318
//

Text Mined References (9)

PMID Year Title