Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.38
PubTator Score 0.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.600 2.2e-04
Astrocytoma, Pilocytic -1.300 4.9e-05
atypical teratoid / rhabdoid tumor -1.700 2.2e-08
ependymoma -1.300 5.9e-09
glioblastoma -1.300 1.5e-07
group 4 medulloblastoma -1.400 6.8e-04
medulloblastoma, large-cell -2.000 1.1e-05
primitive neuroectodermal tumor -1.400 2.0e-03

Gene RIF (1)

AA Sequence

MGAQPGEPQNTCSRIQTLFRRVKTLLIKAPPPPQPPPPPPSWNPGCTHVYGYAFGHMHDNNLEHLPSQQV      1 - 70
LDTGEQLMVPVEVLEVDNKEALWKFLLSGAMAGAVSRTGTAPLDRAKVYMQVYSSKTNFTNLLGGLQSMV     71 - 140
QEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGIQGSPPFQERLLAGSLAVAISQTLINPMEVL    141 - 210
KTRLTLRRTGQYKGLLDCARQILQREGTRALYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDP    211 - 280
SGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKV    281 - 350
LPAGGISYVVYEAMKKTLGI                                                      351 - 370
//

Text Mined References (6)

PMID Year Title