Property Summary

NCBI Gene PubMed Count 17
PubMed Score 37.64
PubTator Score 7.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis 1.049 2.4e-02
Breast cancer -1.500 4.4e-07
breast carcinoma -1.100 7.9e-13
cystic fibrosis 1.108 1.2e-03
diabetes mellitus -1.200 9.0e-03
esophageal adenocarcinoma 1.300 2.0e-02
glioblastoma 1.300 1.5e-02
group 3 medulloblastoma -1.700 3.3e-03
hepatocellular carcinoma -1.300 1.8e-02
intraductal papillary-mucinous neoplasm ... 1.200 6.0e-03
lung carcinoma -1.400 1.4e-16
malignant mesothelioma -1.300 4.0e-06
mucosa-associated lymphoid tissue lympho... 1.514 4.9e-02
non-small cell lung cancer -1.034 3.6e-07
osteosarcoma -4.380 1.1e-06
ovarian cancer -2.200 2.5e-07
pancreatic cancer 1.100 7.4e-03
pancreatic ductal adenocarcinoma liver m... 2.054 1.8e-02
Pick disease 1.100 1.5e-02
pituitary cancer -1.200 2.1e-03
psoriasis -3.000 9.6e-05
Rheumatoid arthritis 2.500 5.0e-04
tuberculosis -1.100 2.3e-02

Gene RIF (6)

AA Sequence

MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEHSVMYPVDSVK      1 - 70
TRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAMYFACYENMKRTLNDVFHHQG     71 - 140
NSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRSAISCIRTVWRTEGLGAFYRSYTTQLTMNIP    141 - 210
FQSIHFITYEFLQEQVNPHRTYNPQSHIISGGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLS    211 - 280
GMANAFRTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY                281 - 338
//

Text Mined References (18)

PMID Year Title