Property Summary

NCBI Gene PubMed Count 16
PubMed Score 33.29
PubTator Score 7.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 2.900 1.3e-04
hepatocellular carcinoma -1.300 1.8e-02
malignant mesothelioma -1.300 4.0e-06
esophageal adenocarcinoma 1.300 2.0e-02
psoriasis -3.000 9.6e-05
osteosarcoma -5.026 2.8e-06
group 4 medulloblastoma -2.400 4.3e-05
cystic fibrosis 1.108 1.2e-03
glioblastoma 1.300 1.5e-02
pancreatic ductal adenocarcinoma liver m... 2.054 1.8e-02
tuberculosis and treatment for 6 months -1.600 6.9e-04
non-small cell lung cancer -1.305 5.7e-11
intraductal papillary-mucinous neoplasm ... 1.200 6.0e-03
ulcerative colitis 2.000 4.7e-06
diabetes mellitus -1.200 9.0e-03
Breast cancer -2.000 7.7e-13
lung carcinoma -1.400 1.4e-16
breast carcinoma -1.100 7.9e-13
Pick disease 1.700 2.6e-04
mucosa-associated lymphoid tissue lympho... 1.514 4.9e-02
ovarian cancer -3.200 1.1e-11
pituitary cancer -2.000 4.0e-06
pancreatic cancer 1.100 7.4e-03

Gene RIF (5)

PMID Text
24854990 RNA-sequencing and Reverse transcriptase PCR showed higher expression of a specific isoform of SLC25A37 in SF3B1-mutant patients, a crucial importer of Fe(2+) into the mitochondria
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
21627978 Data show that abnormal MFRN1 expression can contribute to erythropoietic protoporphyria phenotype in some patients, probably by causing a reduction in FECH activity.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19187226 hypoxia induces the expression of mitoferrin mRNAs through separate mechanisms in erythroid cells

AA Sequence

MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEHSVMYPVDSVK      1 - 70
TRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAMYFACYENMKRTLNDVFHHQG     71 - 140
NSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRSAISCIRTVWRTEGLGAFYRSYTTQLTMNIP    141 - 210
FQSIHFITYEFLQEQVNPHRTYNPQSHIISGGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLS    211 - 280
GMANAFRTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY                281 - 338
//

Text Mined References (17)

PMID Year Title
24854990 2015 Distinct iron architecture in SF3B1-mutant myelodysplastic syndrome patients is linked to an SLC25A37 splice variant with a retained intron.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
21627978 2011 Abnormal mitoferrin-1 expression in patients with erythropoietic protoporphyria.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19805291 2009 Abcb10 physically interacts with mitoferrin-1 (Slc25a37) to enhance its stability and function in the erythroid mitochondria.
19187226 2009 Hypoxia induces erythroid-specific 5-aminolevulinate synthase expression in human erythroid cells through transforming growth factor-beta signaling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16949250 2006 Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system.
16511496 2006 Mitoferrin is essential for erythroid iron assimilation.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11845285 2001 Rapid decrease of RNA level of a novel mouse mitochondria solute carrier protein (Mscp) gene at 4-5 weeks of age.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1372133 1992 Efficiency and limitations of the hn-cDNA library approach for the isolation of human transcribed genes from hybrid cells.