Property Summary

NCBI Gene PubMed Count 23
PubMed Score 635.12
PubTator Score 50.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.100 3.8e-08
glioblastoma -1.500 2.1e-04
atypical teratoid / rhabdoid tumor -1.500 3.4e-10
medulloblastoma, large-cell -1.300 3.5e-04
pancreatic ductal adenocarcinoma liver m... -1.581 3.7e-02
lung cancer 1.100 1.7e-03
adult high grade glioma -1.300 3.7e-04
pilocytic astrocytoma -1.100 1.1e-05
ovarian cancer -2.100 1.9e-05

Gene RIF (5)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
17273968 SLC25A3 protein deficiency is associated with lactic acidosis, hypertrophic cardiomyopathy, and muscular hypotonia
15984930 An analysis of the promoter region of the human mitochondrial phosphate transporter, including its activation and inhibition domains, is reported.

AA Sequence

MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGL      1 - 70
GGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGF     71 - 140
YEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKE    141 - 210
EGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIV    211 - 280
SHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM    281 - 350
PESLKKKLGLTQ                                                              351 - 362
//

Text Mined References (29)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19405953 2009 Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17273968 2007 Mitochondrial phosphate-carrier deficiency: a novel disorder of oxidative phosphorylation.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15984930 2005 Functional analysis of the promoter of the mitochondrial phosphate carrier human gene: identification of activator and repressor elements and their transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9733094 1998 Human mitochondrial transmembrane metabolite carriers: tissue distribution and its implication for mitochondrial disorders.
8575787 1995 Chromosomal localization of the mitochondrial phosphate carrier gene PHC to 12q23.
8168843 1994 Chromosomal localization of genes required for the terminal steps of oxidative metabolism: alpha and gamma subunits of ATP synthase and the phosphate carrier.
8144629 1994 The sequences of human and bovine genes of the phosphate carrier from mitochondria contain evidence of alternatively spliced forms.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7821789 1994 Construction of a human full-length cDNA bank.
1777677 1991 Nucleotide sequence of a human heart cDNA encoding the mitochondrial phosphate carrier.