Property Summary

NCBI Gene PubMed Count 30
PubMed Score 39.63
PubTator Score 32.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma -1.800 2.2e-07
astrocytoma -1.300 1.1e-09
glioblastoma -2.900 8.9e-05
oligodendroglioma -1.200 5.7e-06
cystic fibrosis 1.368 4.0e-04
atypical teratoid / rhabdoid tumor -2.700 1.3e-05
medulloblastoma -1.400 1.3e-03
medulloblastoma, large-cell -3.000 4.9e-05
primitive neuroectodermal tumor -1.900 8.9e-05
intraductal papillary-mucinous adenoma (... -1.900 1.5e-04
Breast cancer -3.700 2.9e-22
pediatric high grade glioma -2.300 5.5e-05
lung carcinoma 1.600 7.2e-18
breast carcinoma -1.300 1.5e-21
Alzheimer's disease -1.200 2.6e-02
Pick disease -2.100 2.9e-04
ductal carcinoma in situ -1.300 4.3e-03
invasive ductal carcinoma -1.700 2.5e-03
ovarian cancer -3.400 6.8e-10

Gene RIF (23)

PMID Text
26934480 UCP4 mRNA of cartilage tissues was decreased in osteoarthritis patients, which was negatively correlated with synovial fluid (SF) leptin concentration.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
22580300 UCP4 is a target effector gene of the NF-kappaB c-Rel prosurvival pathway to mitigate the effects of oxidative stress.
22524567 Neuronal UCP4 exhibits transmembrane chloride transport activity.
22427795 Findings show how UCP4 overexpression increases ATP synthesis by specifically interacting with Complex II.
21621926 UCP4 expression correlated with lymph node metastases, positive estrogen/progesterone receptor expression, and positivity for p53 and Ki-67 in breast carcinomas.
21332312 the association found between the ultra-resistant schizophrenia group and the UCP4 haplotype is noteworthy as it may influence treatment outcome in schizophrenia.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20545631 A homozygous genetic variant of mitochondrial uncoupling protein 4 affects the occurrence of leukoaraiosis.(
20545631 Observational study of gene-disease association. (HuGE Navigator)
20385226 has a significant role in NF-kappaB-mediated prosurvival signaling and cell protection against neurotoxins
19536655 Data describe how variants of mitochondrial uncoupling protein 4 (mUCP4) may contibute to development of multiple sclerosis, since mUCP4 is presumed to be of importance in regulation of the mitochondrial membrane potential and cellular energy metabolism.
19536655 Observational study of gene-disease association. (HuGE Navigator)
19150400 overexpression increases neural cell survival by inducing oxidative phosphorylation, preserving ATP synthesis and mitochondrial membrane potential, and reducing oxidative stress.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of solute carrier family 25, member 27 (SLC25A27) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18755175 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17066476 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17066476 These findings suggest that UCP2 and UCP4 have a modest but important involvement in the genetic etiology of schizophrenia.
17035241 The stabilization of Ca(2+) homeostasis and preservation of mitochondrial function by UCP4 was correlated with reduced mitochondrial reactive oxygen species generation and oxidative stress.
16775390 Results suggest that mitochondrial UCP4 mediates an adaptive shift in energy metabolism and increases the resistance of neurons to metabolic and oxidative stress.
16378686 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRG      1 - 70
MVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVI     71 - 140
GQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTT    141 - 210
YDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQA    211 - 280
VQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGVSPF                               281 - 323
//

Text Mined References (32)

PMID Year Title
26934480 2016 Effects of UCP4 on the Proliferation and Apoptosis of Chondrocytes: Its Possible Involvement and Regulation in Osteoarthritis.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22580300 2012 UCP4 is a target effector of the NF-?B c-Rel prosurvival pathway against oxidative stress.
22524567 2012 Toward understanding the mechanism of ion transport activity of neuronal uncoupling proteins UCP2, UCP4, and UCP5.
22427795 2012 Uncoupling protein-4 (UCP4) increases ATP supply by interacting with mitochondrial Complex II in neuroblastoma cells.
21621926 2011 Mitochondrial UCP4 and bcl-2 expression in imprints of breast carcinomas: relationship with DNA ploidy and classical prognostic factors.
21332312 2011 Association of an UCP4 (SLC25A27) haplotype with ultra-resistant schizophrenia.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20545631 2011 A homozygous genetic variant of mitochondrial uncoupling protein 4 affects the occurrence of leukoaraiosis.
20385226 2010 Transcriptional regulation of UCP4 by NF-kappaB and its role in mediating protection against MPP+ toxicity.
19536655 2009 A homozygous genetic variant of mitochondrial uncoupling protein 4 exerts protection against the occurrence of multiple sclerosis.
19150400 2009 Mitochondrial UCP4 attenuates MPP+ - and dopamine-induced oxidative stress, mitochondrial depolarization, and ATP deficiency in neurons and is interlinked with UCP2 expression.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18755175 2008 Associations between polymorphisms in the mitochondrial uncoupling proteins (UCPs) with T2DM.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17066476 2007 Synergistic association of mitochondrial uncoupling protein (UCP) genes with schizophrenia.
17035241 2006 Mitochondrial uncoupling protein-4 regulates calcium homeostasis and sensitivity to store depletion-induced apoptosis in neural cells.
16775390 2006 Mitochondrial UCP4 mediates an adaptive shift in energy metabolism and increases the resistance of neurons to metabolic and oxidative stress.
16378686 2006 Exclusion of the juvenile myoclonic epilepsy gene EFHC1 as the cause of migraine on chromosome 6, but association to two rare polymorphisms in MEP1A and RHAG.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11994670 2002 The uncoupling proteins.
10928996 2000 Characterization of novel UCP5/BMCP1 isoforms and differential regulation of UCP4 and UCP5 expression through dietary or temperature manipulation.
10772343 2000 Specific sequence of motifs of mitochondrial uncoupling proteins.
10620491 2000 The uncoupling protein homologues: UCP1, UCP2, UCP3, StUCP and AtUCP.
10025957 1999 UCP4, a novel brain-specific mitochondrial protein that reduces membrane potential in mammalian cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.