Property Summary

NCBI Gene PubMed Count 11
PubMed Score 36.96
PubTator Score 19.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 28 1 0.0 0.0
Disease Target Count Z-score Confidence
Heart disease 306 0.0 3.0

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 1.4e-02
Breast cancer -1.300 4.1e-05
ependymoma -1.400 2.8e-02
glioblastoma -1.100 7.5e-04
group 4 medulloblastoma -1.200 5.3e-04
oligodendroglioma -1.300 2.4e-02
osteosarcoma -1.538 5.5e-06
primitive neuroectodermal tumor -1.300 7.7e-04

Gene RIF (5)

AA Sequence

MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFHGIYAGVPSAAIGSFPNAAAFFIT      1 - 70
YEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGIQGL     71 - 140
YRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLA    141 - 210
KAGSSTADGNVLSVLHGVWRSQGLAGLFAGVFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP          211 - 274
//

Text Mined References (12)

PMID Year Title